AIF1 Protein, Human (C-His)
Based on 1 Customer Validation
AIF1 Protein, Human (C-His), the recombinant human allograft inflammatory factor 1, has a His tag at the C-terminus. Allograft inflammatory factor-1 (AIF1) is an inflammatory cytokine produced mainly by macrophages within human white adipose tissue.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
AIF1 Protein, Human (C-His), the recombinant human allograft inflammatory factor 1, has a His tag at the C-terminus. Allograft inflammatory factor-1 (AIF1) is an inflammatory cytokine produced mainly by macrophages within human white adipose tissue[1].
Allograft Inflammatory Factor-1 (AIF-1) is a cytoplasmic, calcium-binding, inflammation-responsive scaffold protein that is mainly expressed in immunocytes. AIF-1 influences the immune system at several key points and thus modulates inflammatory diseases. AIF-1 boosts the expression of inflammatory mediators such as cytokines, chemokines, inducible nitric oxide synthase (iNOS) and promotes inflammatory cell proliferation and migration[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
P55008 (S2-P147)
-
Molecular Construction
-
N-term
-
AIF1 (S2-P147)
Accession # P55008 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AIF1; Interferon Gamma Responsive Transcript; Allograft Inflammatory Factor 1; Em:AF129756.17; AIF-1; Protein G1; IBA1; IRT1; Ionized Calcium-Binding Adapter Molecule 1; G1; IRT-1
-
AA Sequence
SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
