DNMT3A Protein, Human (His, Myc)
Based on 1 Customer Validation
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q9Y6K1-3 (M1-P166)
-
Gene ID1788
-
Molecular Construction
-
N-term
-
10*His
-
DNMT3A (M1-P166)
Accession # Q9Y6K1-3 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
DNMT3A; DNA (Cytosine-5-)-Methyltransferase; DNA Methyltransferase 3 Alpha; DNA Cytosine Methyltransferase 3A2; DNA (Cytosine-5)-Methyltransferase 3A; DNA Methyltransferase HsaIIIA; Cysteine Methyltransferase DNMT3A; DNMT3A2; DNA (Cytosine-5-)-Methyltrans
-
AA Sequence
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGESSAPGAASSGPTSIP
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
