EDIL3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, His) is the recombinant human-derived EDIL3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, His) is the recombinant human-derived EDIL3 protein, expressed by HEK293 , with C-6*His labeled tag.
The EDIL3 Protein plays a pivotal role in promoting the adhesion of endothelial cells by interacting with the alpha-v/beta-3 integrin receptor. Concurrently, EDIL3 exerts an inhibitory effect on the formation of vascular-like structures, suggesting its regulatory role in processes related to angiogenesis. This protein is implicated in the intricate orchestration of vascular morphogenesis and remodeling during embryonic development, highlighting its significance in shaping the vascular architecture. The dynamic interplay between EDIL3 and the alpha-v/beta-3 integrin receptor underscores its potential as a key mediator in cellular adhesion and the regulation of vascular morphogenesis, contributing to our understanding of fundamental processes crucial for embryonic development.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O43854-1 (D24-E480)
-
Gene ID10085
-
Molecular Construction
-
N-term
-
EDIL3 (D24-E480)
Accession # O43854-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
EDIL3; Developmentally-Regulated Endothelial Cell Locus 1 Protein; EGF Like And Discoidin Domains 3; EGF-Like Repeats And Discoidin I-Like Domains 3; DEL1; Integrin-Binding Protein DEL1; EGF Like Repeats And Discoidin Domains 3; Developmental Endothelial
-
AA Sequence
DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
-
Predicted Molecular Mass
53.1 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 6% trehalose, 4% mannitol, 100 mM NaCl, 0.05% Tween 80, pH 5.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 5% trehalose, 100 mM NaCl, 6% mannitol, 0.05% Tween 80, pH 4.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
