EGFP Protein, Aequorea victoria
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P42212 (M1-K238) with several site mutations
-
Gene ID/
-
Molecular Construction
-
N-term
-
EGFP (M1-K239) with several site mutations
Accession # P42212 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EGFR; Epidermal Growth Factor Receptor Variant EX12_14del; Prev. ERBB; Cell Proliferation-Inducing Protein 61; ERBB1; Cell Growth Inhibiting Protein 40; ERRP; Receptor Protein-Tyrosine Kinase; Receptor Tyrosine-Protein Kinase ErbB-1; Alternative Protein E
-
AA Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
-
Predicted Molecular Mass
26.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
