Esterase Protein, Enterobacter asburiae (His)
Esterase Protein, Enterobacter asburiae (His) is the recombinant Esterase protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
보관:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- 각종 서류
- Help & FAQs
Biological Activity
Esterase Protein, Enterobacter asburiae (His) is the recombinant Esterase protein, expressed by E. coli, with N-6*His labeled tag.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
A0A495KHB9 (M1-L240)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
Esterase (M1-L240)
Accession # A0A495KHB9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Peptidase_S9 domain-containing protein; DFS27_2276
-
AA Sequence
MIEIEIRHLGDHEILHAMPAGKRDKPLPVVVFYHGFTSSKLVYSYFAVALAQAGFRVVMPDAPDHGARFMGNEQARLGQFWQILHGSLTEFAVLRDALYEAGLVADNRLAVAGASMGGMTALGIMTHHPEVTSVACLMGSGYFTSLAKTLFPPQDLTEMTATLAEWEVTRALPRVADRPLLLWHGDADDVVPPEGTFRLQQALMNEGLDGNLTCLWEPGVRHRITPTALDATVAFFRQHL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
각종 서류
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
