FADD Protein, Human (His)
FADD Protein, Human (His) is the recombinant human-derived FADD, expressed by E. coli , with His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
FADD Protein, Human (His) is the recombinant human-derived FADD, expressed by E. coli , with His labeled tag.
FADD is an apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors. The resulting complex, called the death-inducing signaling complex (DISC), performs proteolytic activation of CASP8. Active CASP8 initiates the subsequent cascade of caspases mediating apoptosis. Additionally, FADD is involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling. by similar content includes: FADD's function in DISC and its role in the apoptotic cascade.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
Q13158 (M1-S208)
-
Gene ID8772
-
Protein Length
Full Length
-
Synonyms
FADD; Mediator Of Receptor-Induced Toxicity; Fas Associated Via Death Domain; FAS-Associated Death Domain Protein; MORT1; FAS-Associating Death Domain-Containing Protein; Growth-Inhibiting Gene 3 Protein; Mediator Of Receptor Induced Toxicity; GIG3; Fas-A
-
AA Sequence
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)