GATA2 Protein, Human (His, Strep)
Based on 1 Customer Validation
GATA2 Protein, Human (His, Strep) is the recombinant human-derived GATA2, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GATA2 Protein, Human (His, Strep) is the recombinant human-derived GATA2, expressed by E. coli , with Strep, His labeled tag.
GATA2 is a transcriptional activator that regulates the expression of the endothelin-1 gene in endothelial cells. It functions by binding to the consensus sequence 5'-AGATAG-3'.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P23769-1 (G292-S401)
-
Gene ID2624
-
Protein Length
Partial
-
Synonyms
GATA2; GATA-Binding Protein 2; GATA Binding Protein 2; MONOMAC; NFE1B; IMD21; Endothelial Transcription Factor GATA-2; DCML
-
AA Sequence
GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMS
-
Predicted Molecular Mass
15.5 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
