GFPT1 Protein, Human
Based on 1 Customer Validation
As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.
The GFPT1 protein exerts control over the flux of glucose into the hexosamine pathway and is likely crucial in regulating the availability of precursors necessary for both N- and O-linked glycosylation of proteins. Additionally, it plays a role in the circadian regulation of clock genes such as BMAL1 and CRY1, suggesting its involvement in modulating circadian rhythms. Moreover, GFPT1 is implicated in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, particularly influencing its effects on hyaluronan synthesis during tissue remodeling. These diverse functions underscore the significance of GFPT1 in coordinating metabolic processes and cellular responses related to glycosylation, circadian rhythm, and tissue remodeling.
Measured by its ability to catalyzes the reaction of glutamine and F-6-P to produce glutamate and GlcN-6-P. The specific activity is 1.038 nmoL/min/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q06210-1/AAA58502.1 (Q332-E699)
-
Molecular Construction
-
N-term
-
GFPT1 (Q332-E699)
Accession # Q06210-1/AAA58502.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
GFPT1; GFAT 1; Prev. GFPT; Glutamine--Fructose-6-Phosphate Transaminase (Isomerizing); GFAT1; Glutamine-Fructose-6-Phosphate Transaminase 1; GFAT; CMSTA1; GFA; GFAT1m; Glutamine--Fructose-6-Phosphate Aminotransferase [Isomerizing] 1; GFPT1L; Glutamine:Fru
-
AA Sequence
QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
