1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. HERC2 Protein, Human (His)

The HERC2 protein is an E3 ubiquitin protein ligase that tightly regulates ubiquitin-dependent retention of repair proteins on damaged chromosomes, especially in response to ionizing radiation (IR). HERC2 is recruited to DNA damage sites and promotes the assembly of UBE2N and RNF8, promoting "Lys-63" linked ubiquitin chains to produce DNA damage-induced responses. HERC2 Protein, Human (His) is the recombinant human-derived HERC2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HERC2 protein is an E3 ubiquitin protein ligase that tightly regulates ubiquitin-dependent retention of repair proteins on damaged chromosomes, especially in response to ionizing radiation (IR). HERC2 is recruited to DNA damage sites and promotes the assembly of UBE2N and RNF8, promoting "Lys-63" linked ubiquitin chains to produce DNA damage-induced responses. HERC2 Protein, Human (His) is the recombinant human-derived HERC2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HERC2 Protein, functioning as an E3 ubiquitin-protein ligase, plays a crucial role in the regulation of ubiquitin-dependent retention of repair proteins on damaged chromosomes, particularly in response to ionizing radiation (IR). Upon recruitment to sites of DNA damage, HERC2 facilitates the assembly of UBE2N and RNF8, promoting the formation of 'Lys-63'-linked ubiquitin chains crucial for DNA damage-induced responses. Acting as a mediator between UBE2N and RNF8, it ensures binding specificity, while also contributing to the maintenance of RNF168 levels. Moreover, HERC2 serves as an E3 ligase that orchestrates the ubiquitination and subsequent proteasomal degradation of XPA, impacting the circadian oscillation of DNA excision repair activity. Beyond its role in DNA repair, HERC2 indirectly regulates the insulin-like growth factor receptor signaling pathway by controlling the steady-state expression of the IGF1R receptor. Additionally, HERC2 plays a role in iron metabolism by modulating the basal turnover of FBXL5. This multifaceted functionality highlights the importance of HERC2 in coordinating various cellular processes essential for genomic stability and signaling regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95714 (S3951-P4321)

Gene ID

8924

Molecular Construction
N-term
6*His
HERC2 (S3951-P4321)
Accession # O95714
C-term
Protein Length

Partial

Synonyms
HERC2; E3 ubiquitin-protein ligase HERC2; HECT domain and RCC1-like domain-containing protein 2; HECT-type E3 ubiquitin transferase HERC2
AA Sequence

SGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKP

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HERC2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HERC2 Protein, Human (His)
Cat. No.:
HY-P701527
Quantity:
MCE Japan Authorized Agent: