HERC2 Protein, Human (His)

The HERC2 protein is an E3 ubiquitin protein ligase that tightly regulates ubiquitin-dependent retention of repair proteins on damaged chromosomes, especially in response to ionizing radiation (IR). HERC2 is recruited to DNA damage sites and promotes the assembly of UBE2N and RNF8, promoting "Lys-63" linked ubiquitin chains to produce DNA damage-induced responses. HERC2 Protein, Human (His) is the recombinant human-derived HERC2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The HERC2 protein is an E3 ubiquitin protein ligase that tightly regulates ubiquitin-dependent retention of repair proteins on damaged chromosomes, especially in response to ionizing radiation (IR). HERC2 is recruited to DNA damage sites and promotes the assembly of UBE2N and RNF8, promoting "Lys-63" linked ubiquitin chains to produce DNA damage-induced responses. HERC2 Protein, Human (His) is the recombinant human-derived HERC2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HERC2 Protein, functioning as an E3 ubiquitin-protein ligase, plays a crucial role in the regulation of ubiquitin-dependent retention of repair proteins on damaged chromosomes, particularly in response to ionizing radiation (IR). Upon recruitment to sites of DNA damage, HERC2 facilitates the assembly of UBE2N and RNF8, promoting the formation of 'Lys-63'-linked ubiquitin chains crucial for DNA damage-induced responses. Acting as a mediator between UBE2N and RNF8, it ensures binding specificity, while also contributing to the maintenance of RNF168 levels. Moreover, HERC2 serves as an E3 ligase that orchestrates the ubiquitination and subsequent proteasomal degradation of XPA, impacting the circadian oscillation of DNA excision repair activity. Beyond its role in DNA repair, HERC2 indirectly regulates the insulin-like growth factor receptor signaling pathway by controlling the steady-state expression of the IGF1R receptor. Additionally, HERC2 plays a role in iron metabolism by modulating the basal turnover of FBXL5. This multifaceted functionality highlights the importance of HERC2 in coordinating various cellular processes essential for genomic stability and signaling regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • HERC2 (S3951-P4321)
      Accession # O95714
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HERC2; Hect Domain And RCC1-Like Domain-Containing Protein 2; HECT And RLD Domain Containing E3 Ubiquitin Protein Ligase 2; HECT Domain And RCC1-Like Domain-Containing Protein 2; E3 Ubiquitin-Protein Ligase HERC2; Probable E3 Ubiquitin-Protein Ligase HERC

  • AA Sequence

    SGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKP

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00