IGFBP-7 Protein, Human (Biotinylated, HEK293, hFc, Avi)
IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (Biotinylated, HEK293, hFc, Avi) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293, with Avi and C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (Biotinylated, HEK293, hFc, Avi) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293, with Avi and C-hFc labeled tag.
IGFBP-7 protein exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. It is worth noting that the significance of its interaction with VPS24/CHMP3 remains uncertain and requires further investigation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
Q16270-1 (S27-L282)
-
Gene ID3490
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Conjugation
Biotin
-
Synonyms
IGFBP7; IGFBP-RP1; Insulin Like Growth Factor Binding Protein 7; IBP-7; IGFBP-7; TAF; MAC25; Insulin-Like Growth Factor Binding Protein 7; PSF; MAC25 Protein; FSTL2; Angiomodulin; Insulin-Like Growth Factor-Binding Protein 7; IGFBP-7v; Prostacyclin-Stimul
-
AA Sequence
SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
-
Predicted Molecular Mass
55 kDa
-
Molecular Weight
Approximately 62-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
