LASP1 Protein, Human (His)
LASP1 Protein, Human (His) is the recombinant human-derived LASP1 , expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Speicherung:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biologische Aktivität
LASP1 Protein, Human (His) is the recombinant human-derived LASP1 , expressed by E. coli , with C-6*His labeled tag.
LASP1 plays an important role in regulating dynamic actin-based cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also regulate actin-associated ion transport activities, not only in parietal cells but also in certain other F-actin-rich secretory epithelial cell types (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q14847-1 (M1-I261)
-
Gene ID3927
-
Molecular Construction
-
N-term
-
LASP1 (M1-I261)
Accession # Q14847-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LASP1; Lasp-1; LIM And SH3 Protein 1; Metastatic Lymph Node Gene 50 Protein; MLN50; MLN 50; LIM And SH3 Domain Protein 1; LASP-1
-
AA Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
-
Predicted Molecular Mass
36.6 kDa
-
Reinheit
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1.0 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)