NINJ1 Protein, Mouse (Cell-Free, His)

Customer Review

Based on 1 Customer Validation

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

NINJ1 Protein serves as a pivotal effector in programmed cell death, mediating plasma membrane rupture in necroptosis and pyroptosis. Downstream of Gasdermin or MLKL activation, NINJ1 oligomerizes in response to death stimuli, introducing hydrophilic faces of two alpha helices into the hydrophobic membrane, leading to the release of damage-associated molecular patterns (DAMPs) and propagating the inflammatory response. Additionally, NINJ1 acts as a regulator of Toll-like receptor 4 (TLR4) signaling during systemic inflammation by directly binding lipopolysaccharide (LPS). It contributes to leukocyte migration, transendothelial migration of macrophages, and promotes monocyte migration to central nervous system inflammatory lesions. Functioning as a homophilic transmembrane adhesion molecule, NINJ1 is involved in axonal growth, cell chemotaxis, angiogenesis, and cell-to-cell interactions between immune cells and endothelial cells. It plays diverse roles in nerve regeneration, angiogenesis, vascular formation, osteoclast development, striated muscle growth, and differentiation. The secreted form exhibits chemotactic activity and acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis.

Technical Parameters

  • Species Mouse
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • NINJ1 (M1-Q152)
      Accession # O70131
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    NINJ1; Ninjurin-1; Ninjurin 1; HNINJ1; NIN1; Nerve Injury-Induced Protein 1; Nerve Injury-Induced Protein-1; NINJURIN

  • AA Sequence

    MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 19 kDa & 35 kDa & 57 kDa & 76 kDa & 114 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00