NINJ1 Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
NINJ1 Protein serves as a pivotal effector in programmed cell death, mediating plasma membrane rupture in necroptosis and pyroptosis. Downstream of Gasdermin or MLKL activation, NINJ1 oligomerizes in response to death stimuli, introducing hydrophilic faces of two alpha helices into the hydrophobic membrane, leading to the release of damage-associated molecular patterns (DAMPs) and propagating the inflammatory response. Additionally, NINJ1 acts as a regulator of Toll-like receptor 4 (TLR4) signaling during systemic inflammation by directly binding lipopolysaccharide (LPS). It contributes to leukocyte migration, transendothelial migration of macrophages, and promotes monocyte migration to central nervous system inflammatory lesions. Functioning as a homophilic transmembrane adhesion molecule, NINJ1 is involved in axonal growth, cell chemotaxis, angiogenesis, and cell-to-cell interactions between immune cells and endothelial cells. It plays diverse roles in nerve regeneration, angiogenesis, vascular formation, osteoclast development, striated muscle growth, and differentiation. The secreted form exhibits chemotactic activity and acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
O70131 (M1-Q152)
-
Gene ID18081
-
Molecular Construction
-
N-term
-
10*His
-
NINJ1 (M1-Q152)
Accession # O70131 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NINJ1; Ninjurin-1; Ninjurin 1; HNINJ1; NIN1; Nerve Injury-Induced Protein 1; Nerve Injury-Induced Protein-1; NINJURIN
-
AA Sequence
MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ
-
Predicted Molecular Mass
18.1 kDa
-
Molecular Weight
Approximately 19 kDa & 35 kDa & 57 kDa & 76 kDa & 114 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)