NRAS Protein, Human (N-His)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

NRAS, a member of the Ras protein family, is characterized by its ability to bind GDP/GTP and possess intrinsic GTPase activity. This inherent property allows NRAS to actively participate in cellular processes by regulating the cycling between GDP-bound inactive and GTP-bound active states. The dynamic interplay of NRAS with guanine nucleotides underscores its role as a molecular switch, influencing downstream signaling pathways and cellular responses. As a key component in signal transduction cascades, NRAS contributes to the intricate regulation of cellular functions and plays a crucial role in various physiological and pathological processes.

Measured by its ability to catalyze the substrate GTP. The specific activity is 0.954 nmol/min/mg.

Human

E. coli

N-8*His

P01111 (M1-C186)

4893

Full Length of Mature Protein

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Approximately 23 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.