NRAS Protein, Human (N-His)
Based on 1 Customer Validation
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
NRAS, a member of the Ras protein family, is characterized by its ability to bind GDP/GTP and possess intrinsic GTPase activity. This inherent property allows NRAS to actively participate in cellular processes by regulating the cycling between GDP-bound inactive and GTP-bound active states. The dynamic interplay of NRAS with guanine nucleotides underscores its role as a molecular switch, influencing downstream signaling pathways and cellular responses. As a key component in signal transduction cascades, NRAS contributes to the intricate regulation of cellular functions and plays a crucial role in various physiological and pathological processes.
Measured by its ability to catalyze the substrate GTP. The specific activity is 0.954 nmol/min/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
P01111 (M1-C186)
-
Gene ID4893
-
Molecular Construction
-
N-term
-
8*His
-
NRAS (M1-C186)
Accession # P01111 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NRAS; Proto-Oncogene GTPase; NRAS Proto-Oncogene, GTPase; N-Ras Protein Part 4; N-Ras; ALPS4; Neuroblastoma RAS Viral (V-Ras) Oncogene Homolog; NRAS1; Neuroblastoma RAS Viral Oncogene Homolog; HRAS1; Transforming Protein N-Ras; CMNS; GTPase NRas; NCMS; V-
-
AA Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
-
Predicted Molecular Mass
22.3 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
