NucA Protein, S. marcescens
Based on 1 Customer Validation
The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.
NucA is an enzyme that catalyzes the hydrolysis of both DNA and RNA, targeting the 3' position of the phosphodiester bond and producing 5'-phosphorylated mono-, di-, tri-, and tetranucleotides. It exhibits activity on both double- and single-stranded nucleic acids, with DNA being a slightly more favorable substrate compared to RNA. NucA's ability to cleave phosphodiester bonds in nucleic acids results in the generation of smaller nucleotide fragments. This enzymatic activity suggests a role in nucleic acid metabolism, potentially contributing to the turnover and recycling of nucleotide components within the cell. It has to succinctly describe NucA's substrate specificity and its capacity to hydrolyze both DNA and RNA at the 3' position of the phosphodiester bond, emphasizing its role in nucleic acid cleavage.
Measured by its ability to hydrolyze DNA from salmon testes that incubate at room temperature for 30 minutes. The specific activity is 210792.34 pmol/min/µg.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P13717 (M1-N266)
-
Gene ID87005285
-
Molecular Construction
-
N-term
-
NucA (M1-N266)
Accession # P13717 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Nuclease; EC:3.1.30.2; Endonuclease; Nuclease isoform Sm2; Nuclease isoform Sm3; Nuclease isoform Sm1; nucA; nuc
-
AA Sequence
MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
