1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. SENP3 Protein, Human (GST)

The SENP3 protein is a key protease in protein sumoylation and can efficiently release SUMO2 and SUMO3 from substrates but is less active on SUMO1 conjugates. Its regulatory effects span multiple cellular processes, including dissociation of SUMO2 from MEF2D, enhancing its transcriptional activation, and dissociation from CDCA8, affecting cellular dynamics. SENP3 Protein, Human (GST) is the recombinant human-derived SENP3 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SENP3 protein is a key protease in protein sumoylation and can efficiently release SUMO2 and SUMO3 from substrates but is less active on SUMO1 conjugates. Its regulatory effects span multiple cellular processes, including dissociation of SUMO2 from MEF2D, enhancing its transcriptional activation, and dissociation from CDCA8, affecting cellular dynamics. SENP3 Protein, Human (GST) is the recombinant human-derived SENP3 protein, expressed by E. coli , with N-GST labeled tag.

Background

SENP3 protein emerges as a pivotal protease in the intricate world of protein sumoylation, exhibiting a potent ability to release SUMO2 and SUMO3 monomers from sumoylated substrates, with weaker activity against SUMO1 conjugates. Its regulatory influence extends to various cellular processes, as SENP3 is involved in deconjugating SUMO2 from MEF2D, enhancing its transcriptional activation potential, and from CDCA8, impacting cellular dynamics. Functioning as a redox sensor, SENP3, when redistributed into the nucleoplasm, acts as an effector to boost HIF1A transcriptional activity by desumoylating EP300. It plays a vital role in rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1, while also participating in the regulation of the sumoylation status of ZNF148. Operating as a component of the Five Friends of Methylated CHTOP (5FMC) complex, SENP3 contributes to the desumoylation of ZNF148, leading to the subsequent transactivation of ZNF148 target genes. Furthermore, SENP3 deconjugates SUMO2 from KAT5 and, under oxidative stress, its degradation is impeded, resulting in its stabilization and accumulation in the nucleoplasm.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9H4L4 (E301-V574)

Gene ID

26168

Molecular Construction
N-term
GST
SENP3 (E301-V574)
Accession # Q9H4L4
C-term
Protein Length

Partial

Synonyms
SENP3; Sentrin-specific protease 3; SUMO-1-specific protease 3; Sentrin/SUMO-specific protease SENP3
AA Sequence

EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SENP3 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SENP3 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SENP3 Protein, Human (GST)
Cat. No.:
HY-P701469
Quantity:
MCE Japan Authorized Agent: