UB2L5 Protein, Human (sf9)
QDPR Protein, operating as a catalyst, converts quinonoid dihydrobiopterin into tetrahydrobiopterin, crucial for balancing biopterin cofactors in cellular metabolism. Tetrahydrobiopterin serves as an essential coenzyme in neurotransmitter synthesis and phenylalanine breakdown, emphasizing QDPR's regulatory role in diverse metabolic pathways. UB2L5 Protein, Human (sf9) is the recombinant human-derived UB2L5 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
QDPR Protein, operating as a catalyst, converts quinonoid dihydrobiopterin into tetrahydrobiopterin, crucial for balancing biopterin cofactors in cellular metabolism. Tetrahydrobiopterin serves as an essential coenzyme in neurotransmitter synthesis and phenylalanine breakdown, emphasizing QDPR's regulatory role in diverse metabolic pathways. UB2L5 Protein, Human (sf9) is the recombinant human-derived UB2L5 protein, expressed by sf9 insect cells , with tag free.
QDPR protein plays a pivotal role in cellular biopterin metabolism by catalyzing the conversion of quinonoid dihydrobiopterin into tetrahydrobiopterin. This enzymatic activity is crucial for maintaining the proper balance of biopterin cofactors, as tetrahydrobiopterin is an essential coenzyme involved in various enzymatic reactions, including neurotransmitter synthesis and the breakdown of phenylalanine. The catalytic function of QDPR highlights its significance in regulating biopterin levels and, consequently, its impact on diverse metabolic pathways within the cell.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
A0A1B0GUS4 (A2-D154)
-
Gene ID/
-
Molecular Construction
-
N-term
-
UB2L5 (A2-D154)
Accession # A0A1B0GUS4 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
UBE2L5; Ubiquitin Conjugating Enzyme E2 L5; UBE2L5P; Ubiquitin‑Conjugating Enzyme E2 L5; Ubiquitin‑Protein Ligase L5; Ubiquitin Conjugating Enzyme E2L 5 (Pseudogene); Ubiquitin Conjugating Enzyme E2 L5, Pseudogene; UBCH7N2
-
AA Sequence
AASRRLMKELEEIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRPVD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
