UB2L5 Protein, Human (sf9)

QDPR Protein, operating as a catalyst, converts quinonoid dihydrobiopterin into tetrahydrobiopterin, crucial for balancing biopterin cofactors in cellular metabolism. Tetrahydrobiopterin serves as an essential coenzyme in neurotransmitter synthesis and phenylalanine breakdown, emphasizing QDPR's regulatory role in diverse metabolic pathways. UB2L5 Protein, Human (sf9) is the recombinant human-derived UB2L5 protein, expressed by sf9 insect cells , with tag free.

QDPR protein plays a pivotal role in cellular biopterin metabolism by catalyzing the conversion of quinonoid dihydrobiopterin into tetrahydrobiopterin. This enzymatic activity is crucial for maintaining the proper balance of biopterin cofactors, as tetrahydrobiopterin is an essential coenzyme involved in various enzymatic reactions, including neurotransmitter synthesis and the breakdown of phenylalanine. The catalytic function of QDPR highlights its significance in regulating biopterin levels and, consequently, its impact on diverse metabolic pathways within the cell.

Human

Sf9 insect cells

Tag Free

A0A1B0GUS4 (A2-D154)

/

Full Length of Mature Protein

AASRRLMKELEEIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRPVD

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.