UE2NL Protein, Human (sf9)
The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with tag free.
UE2NL protein is specifically expressed in the epididymis at the protein level, indicating its potential role in the regulation of molecular processes within this reproductive tissue. As a member of the ubiquitin-conjugating enzyme family, UE2NL is likely involved in ubiquitin-mediated signaling pathways, potentially contributing to the post-translational modification of proteins in the epididymal microenvironment. The tissue-specific expression emphasizes the significance of UE2NL in epididymal function, underscoring its potential involvement in molecular events related to reproductive processes or sperm maturation within the epididymis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q5JXB2 (A2-I153)
-
Gene ID389898
-
Molecular Construction
-
N-term
-
UE2NL (A2-I153)
Accession # Q5JXB2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
UBE2NL; Ubiquitin Conjugating Enzyme E2 N Like (Gene/Pseudogene); Putative Ubiquitin‑Conjugating Enzyme E2 N‑Like; Epididymis Tissue Protein Li 174; Ubiquitin‑Conjugating Enzyme E2N‑Like (Gene/Pseudogene); Ubiquitin‑Conjugating Enzyme E2N‑Like; Ubiquitin
-
AA Sequence
AELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAMNSI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
