UPRT Protein, Human (His)
Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) which is an important part of nucleotide metabolism. UPRT localizes to the nucleus and cytoplasm, and is a potential target for rational design of drugs to treat parasitic infections and cancer. UPRT Protein, Human (His) is the recombinant human-derived UPRT protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) which is an important part of nucleotide metabolism. UPRT localizes to the nucleus and cytoplasm, and is a potential target for rational design of drugs to treat parasitic infections and cancer. UPRT Protein, Human (His) is the recombinant human-derived UPRT protein, expressed by E. coli , with N-6*His labeled tag.
Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP). This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. UPRT expressed strongly in human blood leukocytes, liver, spleen and thymus and moderately in the prostate, heart, brain, lung and skeletal muscle. UPRT localizes to the nucleus and cytoplasm. UPRT is a potential target for rational design of drugs to treat parasitic infections and cancer[1][2].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96BW1-1 (M1-D309)
-
Molecular Construction
-
N-term
-
6*His
-
UPRT (M1-D309)
Accession # Q96BW1-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
UPRT; Uracil Phosphoribosyltransferase Homolog; RP11‑311P8.3; FUR1; DKFZp781E1243; MGC23937; Uracil Phosphoribosyltransferase (FUR1) Homolog (S. Cerevisiae); Uracil Phosphoribosyltransferase (FUR1) Homolog; UMP Pyrophosphorylase; UPRTase; UPP
-
AA Sequence
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTHFGQKYFGTD
-
Predicted Molecular Mass
35.9 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
