Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
44 Results for "
Adjuvant-induced
" in MedChemExpress (MCE) Product Catalog:
Products (44)
44 Results for "Adjuvant-induced" in MCE Product Catalog:
300
300 Publications Verification
Synonyms: GSK1120212; JTP-74057
Research Areas:
Infection Neurological Disease Metabolic Disease Inflammation/Immunology Cancer
Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis, cross the blood-brain barrier (BBB), used in research related to subarachnoid hemorrhage (SAH) .
300
300 Publications Verification
Synonyms: GSK-1120212 (DMSO solvate); JTP-74057 (DMSO solvate)
Trametinib (DMSO solvate) (GSK-1120212 (DMSO solvate)) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib (DMSO solvate) activates autophagy and induces apoptosis . This product is in solid form, a DMSO solvate, and a stable crystalline form.
9
Target:
Research Areas:
Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
9
9 Cited Publications
Synonyms: PF-06651600 tosylate
Target:
Research Areas:
Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
2
Target:
Research Areas:
Ampiroxicam is an orally active prodrug of non-steroidal anti-inflammatory drug (NSAID). Ampiroxicam inhibits paw swelling in adjuvant-induced arthritis and acute inflammation models, and suppresses phenylbenzoquinone-induced stretching responses in mice. Ampiroxicam is rapidly and completely converted to Piroxicam (HY-B0253) via non-specific esterases and first-pass metabolism. Ampiroxicam induces contact hypersensitivity and photosensitivity reactions through photoproducts generated by UVA. Ampiroxicam can be used in research related to photosensitivity, adjuvant-induced arthritis, rheumatism, osteoarthritis and other inflammatory diseases .
1
1 Cited Publications
Cat. No.: HY-N0807
CAS No.: 17388-39-5
Category:
other families Monophenols Metabolic Disease Phenols Zanthoxylum chiloperone var. angustifolium Plants Disease Research Fields Cancer
Target:
Synonyms: ICI-54450; Acidum fenclozicum; Mialex
Target:
Research Areas:
Fenclozic acid (ICI-54450) is an orally active anti-inflammatory, analgesic, and antipyretic agent. Fenclozic acid exhibits anti-inflammatory activity in Edadjuvant-induced arthritis and Carrageenin-induced oedema in rats. Fenclozic acid can be used for the research of arthritis .
Cat. No.: HY-153205
Target:
Research Areas:
Aluminum hydroxide adjuvant is a vaccine aluminum adjuvant. The aluminum content is 9-11 mg/mL. Aluminum hydroxide adjuvant induces the differentiation of macrophages into a new type of mature, specialized antigen-presenting cells in vitro . It has a strong adsorption capacity for negatively charged antigens, a significant sustained-release effect, no stress response, high safety, and can effectively induce immune responses in the body. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry.
Research Areas:
Tepoxalin is an orally active dual inhibitor of Cyclooxygenase/Lipoxygenase, with IC50 values of 4.6 μM (sheep cyclooxygenase), 2.85 μM (rat cyclooxygenase), 0.15 μM (rat 5-lipoxygenase), and 3.0 μM (h12-lipoxygenase), respectively. Tepoxalin inhibits ROS production and NF-κB activation. Tepoxalin suppresses the production of thromboxane B2, leukotriene B4, prostaglandins and cytokines, and blocks platelet aggregation. Tepoxalin exhibits potent anti-inflammatory activity in rats with adjuvant-induced arthritis. Tepoxalin possesses analgesic activity. Tepoxalin shows no ulcerogenic activity within the anti-inflammatory dose range. Tepoxalin can be used in studies related to adjuvant-induced arthritis, skin inflammation and Alzheimer's disease .
Cat. No.: HY-W050088
CAS No.: 55453-87-7
Synonyms: HP 549
Target:
Research Areas:
Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
Cat. No.: HY-10999R
CAS No.: 871700-17-3
Synonyms: GSK1120212 (Standard); JTP-74057 (Standard)
Target:
Research Areas:
Trametinib (Standard) is the analytical standard of Trametinib. This product is intended for research and analytical applications. Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis .
Cat. No.: HY-W009706
CAS No.: 22131-79-9
Synonyms: Allopydin; W-7320
Target:
Research Areas:
Alclofenac (Allopydin) is an orally active prostaglandin synthase inhibitor with anti-inflammatory, analgesic and antipyretic activities. Alclofenac irreversibly inhibits platelet aggregation. Alclofenac can be used in research related to rheumatoid arthritis, osteoarthritis, ankylosing spondylitis, low back pain and sciatica .
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-B1130
CAS No.: 34552-84-6
Target:
Research Areas:
Isoxicam is an orally active nonsteroidal anti-inflammatory compound and a COX-1/COX-2 inhibitor. Isoxicam exhibits potent anti-inflammatory activity in rat models of inflammation and significantly lower ulcerogenic risk. Isoxicam can be used for the study of inflammatory diseases and rheumatic disorders .
Cat. No.: HY-116230
CAS No.: 111317-77-2
Target:
Research Areas:
BI-L-45 XX is an orally active anti-inflammatory agent. BI-L-45 XX can inhibit the release of neutrophil enzymes and chemotaxis, and is used in the study of adjuvant-induced arthritis .
Cat. No.: HY-120496
CAS No.: 1204178-50-6
Synonyms: ASP3662
Target:
Research Areas:
Clofutriben (ASP3662) is a selective, orally active and brain-penetrant 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1) inhibitor with Ki values of 5.3 nM (human), 2.6 nM (mouse), and 23 nM (rat). Clofutriben inhibits conversion of inactive glucocorticoids to active glucocorticoids, reducing intracellular glucocorticoid exposure. Clofutriben ameliorates neuropathic pain, and restores muscle pressure thresholds in rodent models, while lacking effects in inflammatory pain .
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-177091
CAS No.: 2171506-45-7
Target:
Research Areas:
AS2795440 is a PIKfyve inhibitor. AS2795440 selectively inhibits proinflammatory cytokine such as IL-12p40 and IL-6 production and B cell activation without affecting Ca 2+ signaling. AS2795440 significantly reduces joint inflammation and bone loss in adjuvant-induced arthritis (AIA) mice model. AS2795440 can be used for inflammatory and autoimmune diseases like rheumatoid arthritis, psoriasis and inflammatory bowel disease research .
Cat. No.: HY-W050088S
CAS No.: 2012598-71-7
Synonyms: HP 549-d6
Cat. No.: HY-100754A
CAS No.: 2140301-97-7
Synonyms: PF-06651600 malonate
Target:
Research Areas:
Ritlecitinib (PF-06651600) malonate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib malonate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib malonate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
