Search Result
Results for "
Adjuvant-induced
" in MedChemExpress (MCE) Product Catalog:
1
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-10999
-
-
-
- HY-100754
-
|
PF-06651600
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
-
- HY-10999A
-
|
GSK-1120212 (DMSO solvate); JTP-74057 (DMSO solvate)
|
MEK
Apoptosis
|
Cancer
|
|
Trametinib (DMSO solvate) (GSK-1120212 (DMSO solvate)) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib (DMSO solvate) activates autophagy and induces apoptosis . This product is in solid form, a DMSO solvate, and a stable crystalline form.
|
-
-
- HY-N0807
-
|
|
MMP
NF-κB
JAK
Keap1-Nrf2
|
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Swertiamarin is an orally active natural product with hypoglycemic, lipid-lowering, anti-rheumatic, and antioxidant activities. Swertiamarin can regulate the levels of pro-inflammatory cytokines, MMP, and NF-κB, and promote osteoblast proliferation. Swertiamarin has antioxidant and hepatoprotective effects against carbon tetrachloride induced rat liver toxicity through the Nrf2/HO-1 pathway. Swertiamarin can attenuate inflammatory mediators by regulating JAK2/STAT3 transcription factors in adjuvant induced arthritis rats. Swertiamarin can be used in the research of diabetes and arthritis .
|
-
-
- HY-100754C
-
|
PF-06651600 tosylate
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
-
- HY-101432
-
|
ICI-54450; Acidum fenclozicum; Mialex
|
COX
|
Inflammation/Immunology
|
|
Fenclozic acid (ICI-54450) is an orally active anti-inflammatory, analgesic, and antipyretic agent. Fenclozic acid exhibits anti-inflammatory activity in Edadjuvant-induced arthritis and Carrageenin-induced oedema in rats. Fenclozic acid can be used for the research of arthritis .
|
-
-
- HY-153205
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
Aluminum hydroxide adjuvant is a vaccine aluminum adjuvant. The aluminum content is 9-11 mg/mL. Aluminum hydroxide adjuvant induces the differentiation of macrophages into a new type of mature, specialized antigen-presenting cells in vitro . It has a strong adsorption capacity for negatively charged antigens, a significant sustained-release effect, no stress response, high safety, and can effectively induce immune responses in the body. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry.
|
-
-
- HY-13219
-
|
|
COX
Lipoxygenase
Reactive Oxygen Species (ROS)
NF-κB
|
Neurological Disease
Inflammation/Immunology
|
|
Tepoxalin is an orally active dual inhibitor of Cyclooxygenase/Lipoxygenase, with IC50 values of 4.6 μM (sheep cyclooxygenase), 2.85 μM (rat cyclooxygenase), 0.15 μM (rat 5-lipoxygenase), and 3.0 μM (h12-lipoxygenase), respectively. Tepoxalin inhibits ROS production and NF-κB activation. Tepoxalin suppresses the production of thromboxane B2, leukotriene B4, prostaglandins and cytokines, and blocks platelet aggregation. Tepoxalin exhibits potent anti-inflammatory activity in rats with adjuvant-induced arthritis. Tepoxalin possesses analgesic activity. Tepoxalin shows no ulcerogenic activity within the anti-inflammatory dose range. Tepoxalin can be used in studies related to adjuvant-induced arthritis, skin inflammation and Alzheimer's disease .
|
-
-
- HY-W050088
-
|
HP 549
|
Drug Derivative
|
Neurological Disease
Inflammation/Immunology
|
|
Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
|
-
-
- HY-10999R
-
|
GSK1120212 (Standard); JTP-74057 (Standard)
|
Reference Standards
MEK
Autophagy
Apoptosis
|
Cancer
|
|
Trametinib (Standard) is the analytical standard of Trametinib. This product is intended for research and analytical applications. Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis .
|
-
-
- HY-W009706
-
|
Allopydin; W-7320
|
Prostaglandin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Alclofenac (Allopydin) is an orally active prostaglandin synthase inhibitor with anti-inflammatory, analgesic and antipyretic activities. Alclofenac irreversibly inhibits platelet aggregation. Alclofenac can be used in research related to rheumatoid arthritis, osteoarthritis, ankylosing spondylitis, low back pain and sciatica .
|
-
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
-
- HY-17484
-
|
CP 65703
|
Drug Derivative
|
Inflammation/Immunology
|
|
Ampiroxicam is an orally active prodrug of non-steroidal anti-inflammatory drug (NSAID). Ampiroxicam inhibits paw swelling in adjuvant-induced arthritis and acute inflammation models, and suppresses phenylbenzoquinone-induced stretching responses in mice. Ampiroxicam is rapidly and completely converted to Piroxicam (HY-B0253) via non-specific esterases and first-pass metabolism. Ampiroxicam induces contact hypersensitivity and photosensitivity reactions through photoproducts generated by UVA. Ampiroxicam can be used in research related to photosensitivity, adjuvant-induced arthritis, rheumatism, osteoarthritis and other inflammatory diseases .
|
-
-
- HY-B1130
-
|
|
COX
|
Inflammation/Immunology
|
|
Isoxicam is an orally active nonsteroidal anti-inflammatory compound and a COX-1/COX-2 inhibitor. Isoxicam exhibits potent anti-inflammatory activity in rat models of inflammation and significantly lower ulcerogenic risk. Isoxicam can be used for the study of inflammatory diseases and rheumatic disorders .
|
-
-
- HY-116230
-
|
|
Ser/Thr Protease
|
Inflammation/Immunology
|
|
BI-L-45 XX is an orally active anti-inflammatory agent. BI-L-45 XX can inhibit the release of neutrophil enzymes and chemotaxis, and is used in the study of adjuvant-induced arthritis .
|
-
-
- HY-120496
-
|
ASP3662
|
11β-HSD
|
Neurological Disease
Metabolic Disease
|
|
Clofutriben (ASP3662) is a selective, orally active and brain-penetrant 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1) inhibitor with Ki values of 5.3 nM (human), 2.6 nM (mouse), and 23 nM (rat). Clofutriben inhibits conversion of inactive glucocorticoids to active glucocorticoids, reducing intracellular glucocorticoid exposure. Clofutriben ameliorates neuropathic pain, and restores muscle pressure thresholds in rodent models, while lacking effects in inflammatory pain .
|
-
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
-
- HY-177091
-
|
|
PIKfyve
Interleukin Related
MHC
|
Inflammation/Immunology
|
|
AS2795440 is a PIKfyve inhibitor. AS2795440 selectively inhibits proinflammatory cytokine such as IL-12p40 and IL-6 production and B cell activation without affecting Ca 2+ signaling. AS2795440 significantly reduces joint inflammation and bone loss in adjuvant-induced arthritis (AIA) mice model. AS2795440 can be used for inflammatory and autoimmune diseases like rheumatoid arthritis, psoriasis and inflammatory bowel disease research .
|
-
-
- HY-W050088S
-
|
HP 549-d6
|
Isotope-Labeled Compounds
Drug Derivative
|
Neurological Disease
Inflammation/Immunology
|
|
Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
|
-
-
- HY-100754A
-
|
PF-06651600 malonate
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Ritlecitinib (PF-06651600) malonate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib malonate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib malonate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
-
- HY-163756
-
-
-
- HY-147660
-
|
|
LPL Receptor
|
Inflammation/Immunology
|
|
IMMH001, also called SYL930, is an orally active, potent and selective S1P1 (sphingosine-1-phosphate receptor 1) agonist. IMMH001 decreased levels of both chemokines and proinflammatory cytokines, including IL-1β, IL-5, IL-18, IP10, CCL3, and CCL5. IMMH001 can be used for rheumatoid arthritis (RA) research .
|
-
-
- HY-114897
-
|
|
p38 MAPK
|
Inflammation/Immunology
|
|
L-167307 is an effective pyrrole-based p38 kinase inhibitor that can reduce secondary paw swelling in rat adjuvant-induced arthritis models .
|
-
-
- HY-17484R
-
|
CP 65703 (Standard)
|
Reference Standards
|
Inflammation/Immunology
|
|
Ampiroxicam (Standard) is the analytical standard of Ampiroxicam. This product is intended for research and analytical applications. Ampiroxicam is an orally active prodrug of non-steroidal anti-inflammatory drug (NSAID). Ampiroxicam inhibits paw swelling in adjuvant-induced arthritis and acute inflammation models, and suppresses phenylbenzoquinone-induced stretching responses in mice. Ampiroxicam is rapidly and completely converted to Piroxicam (HY-B0253) via non-specific esterases and first-pass metabolism. Ampiroxicam induces contact hypersensitivity and photosensitivity reactions through photoproducts generated by UVA. Ampiroxicam can be used in research related to photosensitivity, adjuvant-induced arthritis, rheumatism, osteoarthritis and other inflammatory diseases.
|
-
-
- HY-N8458
-
|
NSC 272693
|
PGE synthase
|
Inflammation/Immunology
|
|
Cryogenine is an alkaloid originally isolated from H. salicifolia that has anti-inflammatory activity. It inhibits prostaglandin synthetase (IC50=424 μM). Cryogenine (100 mg/kg per day, p.o.) reduces paw edema and the mean arthritic index in a rat model of adjuvant-induced polyarthritis.
|
-
-
- HY-114873
-
|
LY25684
|
Phospholipase
COX
Lipoxygenase
Leukotriene Receptor
|
Inflammation/Immunology
|
|
LY256548 (LY25648) is an orally available anti-ischemic and anti-inflammatory compound with central nervous system activity. LY256548 is an inhibitor of phospholipase A2, 5-lipoxygenase (5-LOX), and COX, and inhibits A23187 (HY-N6687)-stimulated leukotriene B4 production. LY256548 inhibits bone damage and paw swelling in the rat Freund's complete adjuvant-induced arthritis (FCA) model .
|
-
-
- HY-121856
-
|
|
Others
|
Inflammation/Immunology
|
|
Flumizole, a derivative of substituted 5,6-diaryl-2,3-dihydroimidazo[2,1-b]thiazoles, was synthesized and evaluated for its immunoregulatory and anti-inflammatory properties in animal models such as rat adjuvant-induced arthritis and mouse oxazolone-induced contact sensitivity assays. This compound class combines structural elements from flumizole and levamisole, aiming to enhance therapeutic efficacy. Symmetrically substituted 5,6-diaryl compounds with specific alkyl heteroatom or halogen substitutions showed optimal potency in the arthritis model. However, variations in activity were less consistent in the contact sensitivity assay. Flumizole and related compounds demonstrate potential as dual-action agents, targeting inflammation and immune modulation, offering promise for therapeutic development in immune-related disorders .
|
-
-
- HY-163412
-
|
|
IKK
|
Inflammation/Immunology
|
|
IKKβ-IN-3 (Compound hit4) is a IKKβ inhibitor with an IC50 value of 30.4 nM. IKKβ is a key enzyme in the NF-κB signaling pathway and is involved in the development of many diseases. IKKβ-IN-3 can be used in the study of CAF-induced arthritis .
|
-
-
- HY-163368
-
|
|
HDAC
|
Inflammation/Immunology
|
|
HDAC6-IN-34 (compound 21) is an oral active and selective HDAC6 inhibitor with the IC50 of 18 nM. HDAC6-IN-34 increases the acetylation level of tubulin without affecting histone acetylation in cutaneous T-cell lymphoma cells and inhibits TNF-α secretion in LPS (HY-D1056)-stimulated macrophage cells. HDAC6-IN-34 shows excellent anti-arthritic efficacy in rat .
|
-
-
- HY-101670
-
|
(Rac)-M-5011
|
Prostaglandin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
MTPPA ((Rac)-M-5011) is an orally active anti-inflammatory, analgesic and anti-rheumatic compound. MTPPA mediates the inhibition of prostaglandin biosynthesis. MTPPA acts as a four-point tetrahedral organophosphonate bridging ligand. MTPPA can be used in research related to inflammation, pain and adjuvant arthritis .
|
-
-
- HY-182506
-
|
BM 12.531
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
|
Azimexon (BM 12.531) is an orally active immunomodulator with radioprotective and antitumor activities. Azimexon prolongs survival in multiple mouse models, enhances immunity and hematopoiesis, and alleviates radiation injury and tumor metastasis. Azimexon causes reversible hemolytic anemia in rats and dogs, and exerts therapeutic activity against adjuvant-induced arthritis in rats. Azimexon can be used for the research of lung carcinoma, leukemia, multiple myeloma, lung tumor, arthritis, breast cancer and AIDS‑related complex .
|
-
-
- HY-181513
-
|
|
Interleukin Related
TNF Receptor
|
Inflammation/Immunology
|
|
DPP-1-IN-2 is a DPP-I inhibitor with a human IC50 of 36.8 nM and oral efficacy. DPP-1-IN-2 binds to intracellular DPP-I, increases its thermal stability, and reduces the activity and expression levels of downstream neutrophil serine proteases by inhibiting its enzymatic activity. DPP-1-IN-2 regulates the secretion of inflammatory factors and chemokines to exert anti-inflammatory effects. DPP-1-IN-2 reverses joint inflammation and tissue damage in adjuvant-induced arthritis rat models. DPP-1-IN-2 is applicable to research related to arthritis .
|
-
-
- HY-W050088R
-
|
HP 549 (Standard)
|
Reference Standards
Drug Derivative
|
Neurological Disease
Inflammation/Immunology
|
|
Isoxepac (Standard) (HP 549 (Standard)) is the analytical standard of Isoxepac (HY-W050088). This product is intended for research and analytical applications. Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
|
-
-
- HY-100754R
-
|
PF-06651600 (Standard)
|
JAK
Reference Standards
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Ritlecitinib (Standard) is the analytical standard of Ritlecitinib (HY-100754). This product is intended for research and analytical applications. Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
-
- HY-100754CR
-
|
PF-06651600 tosylate (Standard)
|
JAK
Reference Standards
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Ritlecitinib (tosylate) (Standard) is the analytical standard of Ritlecitinib (tosylate) (HY-100754C). This product is intended for research and analytical applications. Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
-
- HY-183918
-
|
|
COX
|
Inflammation/Immunology
|
|
Amfenac ethyl ester is an orally active cyclooxygenase (COX) inhibitor. Amfenac ethyl ester exhibits antiinflammatory activity in rodent models. Amfenac ethyl ester can be used for the research of inflammation .
|
-
-
- HY-N19717
-
|
|
NF-κB
SOD
|
Inflammation/Immunology
Cancer
|
|
Bartogenic acid is an orally active NF-κB inhibitor, found in Barringtonia racemosa fruits. Bartogenic acid increases catalase, superoxide dismutase (SOD), and glutathione levels. Bartogenic acid inhibits lipid peroxidation and suppresses inflammation markers. Bartogenic acid can be used for the research of ovarian cancer, skin cancer, and inflammatory conditions .
|
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P4096C
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Cys-scHAP-1 is an N-terminal cysteine-labeled disordered peptide of HAP-1. Cys-scHAP-1 can be used to construct scHAP-1-targeted liposomes, which bind to human and rabbit fibroblast-like synoviocytes and localize to inflamed joints in vivo in a rat adjuvant-induced arthritis model. Cys-scHAP-1 is applicable to arthritis research .
|
-
- HY-P4096B
-
|
|
Peptides
|
Inflammation/Immunology
|
|
scHAP-1 is a scrambled HAP-1 peptide, and HAP-1 is a synovial homing peptide. After amino acid sequence scrambling, scHAP-1 still specifically binds to human and rabbit fibroblast-like synoviocytes (FLS), while showing extremely weak binding to human umbilical vein endothelial cells, which proves that it remains an effective FLS-targeting ligand. scHAP-1 can be used in studies related to rheumatoid arthritis .
|
-
- HY-P4096A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Cys-HAP-1 is a synovium-homing peptide that specifically binds to human and rabbit fibroblast-like synoviocytes, and does not bind to human umbilical vein endothelial cells regardless of TNF-α treatment. Cys-HAP-1 enables targeted drug delivery to inflamed joints after conjugation with liposomes loaded with anti-arthritic agents. Cys-HAP-1 can be used in studies related to adjuvant arthritis .
|
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
| Cat. No. |
Product Name |
Chemical Structure |
-
- HY-W050088S
-
|
|
|
Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
|
-
| Cat. No. |
Product Name |
|
Classification |
-
- HY-153205
-
|
|
|
Adjuvant
|
|
Aluminum hydroxide adjuvant is a vaccine aluminum adjuvant. The aluminum content is 9-11 mg/mL. Aluminum hydroxide adjuvant induces the differentiation of macrophages into a new type of mature, specialized antigen-presenting cells in vitro . It has a strong adsorption capacity for negatively charged antigens, a significant sustained-release effect, no stress response, high safety, and can effectively induce immune responses in the body. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry. It is suitable for various veterinary vaccines, including inactivated vaccines or gene-engineered subunit vaccines for bacterial and viral diseases of livestock and poultry.
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: