Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
51 Results for "
MIP-1
" in MedChemExpress (MCE) Product Catalog:
Products (51)
51 Results for "MIP-1" in MCE Product Catalog:
29
Category:
Neurological Disease Ketones, Aldehydes, Acids Plants Umbelliferae Disease Research Fields Endocrinology Echinacea angustifolia DC. Cancer
Target:
13
13 Cited Publications
Synonyms: Dexamethasone 21-phosphate disodium
Research Areas:
Dexamethasone phosphate (Dexamethasone 21-phosphate) disodium is a prodrug form of the glucocorticoid Dexamethasone (HY-14648). Dexamethasone phosphate disodium is produced by introducing a phosphate ester group at the 21-position of the Dexamethasone molecule, forming a salt with sodium ions, thereby significantly improving water solubility. Dexamethasone phosphate disodium inhibits LPS (HY-D1056)-induced degradation of IRAK-1 and IRAK-4, and blocks LPS-induced activation of TRAF6, p-TAK1 and p-JNK. Dexamethasone phosphate disodium inhibits the secretion of RANTES, TGF-β1 and NO, promotes the production of MIP-1α and IL-10, and blocks microglial migration. Dexamethasone phosphate disodium is almost completely converted to Dexamethasone in rat blood, and supports transdermal delivery via iontophoresis. Dexamethasone phosphate disodium can be used in research related to steroid-dependent ulcerative colitis, chemotherapy-induced vomiting, allergic asthma and acute colitis (inflammatory bowel disease) [1] .
13
Research Areas:
Dexamethasone phosphate (Dexamethasone 21-phosphate) is a prodrug form of the glucocorticoid Dexamethasone (HY-14648). Dexamethasone phosphate is prepared by introducing a phosphate ester group to the hydroxyl group at position 21 of the Dexamethasone molecule. Dexamethasone phosphate inhibits LPS (HY-D1056)-induced degradation of IRAK-1 and IRAK-4, and blocks LPS-induced activation of TRAF6, p-TAK1 and p-JNK. Dexamethasone phosphate inhibits the secretion of RANTES, TGF-β1 and NO, promotes the production of MIP-1α and IL-10, and blocks microglial migration. Dexamethasone phosphate is almost completely converted to Dexamethasone in rat blood, and supports transdermal delivery via iontophoresis. Dexamethasone phosphate can be used in research related to steroid-dependent ulcerative colitis, chemotherapy-induced vomiting, allergic asthma and acute colitis (inflammatory bowel disease) [1] .
4
4 Cited Publications
Cat. No.: HY-P7255
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL3; Tonsillar Lymphocyte LD78 Alpha Protein; Prev. SCYA3; C-C Motif Chemokine 3; MIP-1-Alpha; PAT 464.1; G0S19-1; SIS-Beta; LD78ALPHA; MIP1A; LD78; Macrophage Inflammatory Protein 1 Alpha; SCI; Chemokine (C-C Motif) Ligand 3; Small Inducible Cytokine A3
3
3 Cited Publications
Cat. No.: HY-19974
CAS No.: 333994-00-6
Research Areas:
TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
3
3 Cited Publications
Cat. No.: HY-P7257
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
1
1 Cited Publications
Cat. No.: HY-P7768
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL3; Tonsillar Lymphocyte LD78 Alpha Protein; Prev. SCYA3; C-C Motif Chemokine 3; MIP-1-Alpha; PAT 464.1; G0S19-1; SIS-Beta; LD78ALPHA; MIP1A; LD78; Macrophage Inflammatory Protein 1 Alpha; SCI; Chemokine (C-C Motif) Ligand 3; Small Inducible Cytokine A3
1
1 Cited Publications
Cat. No.: HY-P71889
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
1
1 Cited Publications
Cat. No.: HY-P7772
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: Scya9; Scya10; Mrp2; Ccl9; Small-inducible cytokine A9; MRP-2; Macrophage inflammatory protein-related protein 2; MIP-1-gamma; Macrophage inflammatory protein 1-gamma; CCF18; C-C motif chemokine 9
Cat. No.: HY-P5523A
Research Areas:
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-B1829AR
CAS No.: 2392-39-4
Synonyms: Dexamethasone 21-phosphate disodium (Standard)
Research Areas:
Neurological Disease Metabolic Disease Inflammation/Immunology
Dexamethasone phosphate (Dexamethasone 21-phosphate) disodium (Standard) is the analytical standard of Dexamethasone phosphate disodium (HY-B1829A). This product is intended for research and analytical applications. Dexamethasone phosphate (Dexamethasone 21-phosphate) disodium is a prodrug form of the glucocorticoid Dexamethasone (HY-14648). Dexamethasone phosphate disodium is produced by introducing a phosphate ester group at the 21-position of the Dexamethasone molecule, forming a salt with sodium ions, thereby significantly improving water solubility. Dexamethasone phosphate disodium inhibits LPS (HY-D1056)-induced degradation of IRAK-1 and IRAK-4, and blocks LPS-induced activation of TRAF6, p-TAK1 and p-JNK. Dexamethasone phosphate disodium inhibits the secretion of RANTES, TGF-β1 and NO, promotes the production of MIP-1α and IL-10, and blocks microglial migration. Dexamethasone phosphate disodium is almost completely converted to Dexamethasone in rat blood, and supports transdermal delivery via iontophoresis. Dexamethasone phosphate disodium can be used in research related to steroid-dependent ulcerative colitis, chemotherapy-induced vomiting, allergic asthma and acute colitis (inflammatory bowel disease).
Cat. No.: HY-P5523
CAS No.: 592520-07-5
Research Areas:
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-149650
CAS No.: 2374139-51-0
Target:
Research Areas:
TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
Cat. No.: HY-149650A
CAS No.: 3020639-70-4
Target:
Research Areas:
TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
Cat. No.: HY-B0155
CAS No.: 306296-47-9
Synonyms: SCH 417690; SCH-D; MK-7690 free base
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer [1] .
Cat. No.: HY-174744
Target:
Research Areas:
Human CCR4 mRNA encodes the human C-C motif chemokine receptor 4 (CCR4) protein, a member of G protein-coupled receptors family. CCR4 is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.
Cat. No.: HY-RS12274
Target:
Research Areas:
RPTOR Human Pre-designed siRNA Set A contains three designed siRNAs for RPTOR gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
