MIP-1 alpha/CCL3 Protein, Mouse (HEK293)

MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293^[1].

CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It’s known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases^[1].

The ED₅₀ is <100 ng/mL as measured by CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells).

Mouse

HEK293

Tag Free

P10855 (A24-A92)

20302  [NCBI]

Full Length of Mature Protein

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22(20):6625-6632.  [Content Brief]

  [2]. Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22(20):6625-6632.  [Content Brief]

  [3]. Giovanni Bernardini, et al. CCL3 and CXCL12 regulate trafficking of mouse bone marrow NK cell subsets. Blood. 2008 Apr 1;111(7):3626-34.  [Content Brief]