MIP-1 alpha/CCL3 Protein, Mouse (HEK293)
Based on 4 publication(s) in Google Scholar
MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293[1].
Background
CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It’s known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases[1].
Verified Bioactivity
The ED50 is <100 ng/mL as measured by CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells).
Publications (4)
-
Journal Impact Factor
-
Most Recent
-
Bone Res
Lumbar instability remodels cartilage endplate to induce intervertebral disc degeneration by recruiting osteoclasts via Hippo-CCL3 signaling. [Abstract]2024 May 30;12(1):34. PMID: 38816384 -
J Control Release
"Cytokine-microfactories" recruit DCs and deliver tumor antigens via gap junctions for immunotherapy. [Abstract]2021 Sep 10:337:417-430. PMID: 34324896 -
J Invest Dermatol
Multiomics reveals CCL3-driving neuronal sensitization in chronic pruritus of unknown origin. [Abstract]2025 Nov 28:S0022-202X(25)03613-9. PMID: 41320115 -
J Cell Mol Med
The absence of oestrogen receptor beta disturbs collagen I type deposition during Achilles tendon healing by regulating the IRF5-CCL3 axis. [Abstract]2020 Sep;24(17):9925-9935. PMID: 32776630
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
P10855 (A24-A92)
-
Molecular Construction
-
N-term
-
MIP-1 alpha/CCL3 (A24-A92)
Accession # P10855 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL3; Tonsillar Lymphocyte LD78 Alpha Protein; Prev. SCYA3; C-C Motif Chemokine 3; MIP-1-Alpha; PAT 464.1; G0S19-1; SIS-Beta; LD78ALPHA; MIP1A; LD78; Macrophage Inflammatory Protein 1 Alpha; SCI; Chemokine (C-C Motif) Ligand 3; Small Inducible Cytokine A3
-
AA Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22(20):6625-6632. [Content Brief]
[2]. Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22(20):6625-6632. [Content Brief]
[3]. Giovanni Bernardini, et al. CCL3 and CXCL12 regulate trafficking of mouse bone marrow NK cell subsets. Blood. 2008 Apr 1;111(7):3626-34. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
