Beta-defensin 103 isoform X1, pig TFA
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.
For research use only. We do not sell to patients.
- Formula: C348H576N105F3O85S8
- Molecular Weight:7904.56
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
Molecular Weight 7904.56
-
Formula C348H576N105F3O85S8
-
Sequence
Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg-Lys-Arg-Lys
-
Sequence Shortening
MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Beta-defensin 103 isoform X1, pig TFA Related Classifications
HY-P2291A Related Classifications
Powered by Bioz