Beta-defensin 103 isoform X1, pig
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.
For research use only. We do not sell to patients.
- Formula: C346H575N105O83S8
- Molecular Weight:7790.54
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
The defensin family comprises three subfamilies (α-, β- and θ-defensins) and is one of the groups of antimicrobial peptides involved in the innate immune response, being a part of the nonspecific way in which many living organisms react against invading pathogens[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 7790.54
-
Formula C346H575N105O83S8
-
Sequence
Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg-Lys-Arg-Lys
-
Sequence Shortening
MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Beta-defensin 103 isoform X1, pig Related Classifications
HY-P2291 Related Classifications
Powered by Bioz