Margatoxin TFA
Based on 1 publication(s) in Google Scholar
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C178H286N52O50S7.xC2HF3O2
- Masse moléculaire:4178.95 (free base)
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Margatoxin TFA
More
Activité biologique
Description
IC50 & Target
Kd: 11.7 pM (Kv1.3), 6.4 pM (Kv1.2) and 4.2 nM (Kv1.1)[1]
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Masse moléculaire 4178.95 (free base)
-
Formule C178H286N52O50S7.xC2HF3O2
-
Sequence
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Sequence Shortening
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Discov
Therapeutic potential of voltage-dependent potassium channel subtype 1.3 blockade in alleviating macrophage-related renal inflammation and fibrogenesis. [Abstract]2025 May 5;11(1):218. PMID: 40324999
Pureté et documentation
Références
[1]. Bartok A, et al. Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. [Content Brief]
[2]. Chen YC, et al. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Thromb Haemost. 2016 May 2;115(5):1010-24. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)