Copeptin (human) acetate
Based on 1 Customer Validation
Copeptin (human) acetate is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) acetate can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C177H279N49O58·xC2H4O2
- Molecular Weight:4021.40 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Beschreibung
In Vitro
Copeptin (human) (1-100 nM) acetate has no effect on the basal tone and spontaneous myogenic contractions of human proximal or distal gastric circular muscle; it has no effect on the basal tone and spontaneous myogenic contractions of isolated distal gastric tissues from mice; and it has no effect on the tension of isolated mouse aortas pre-contracted to submaximal levels[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4021.40 (free base)
-
Formel C177H279N49O58·xC2H4O2
-
Sequence
Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr
-
Sequence Shortening
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Reinheit & Dokumentation
Verweise
[1]. Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Frontiers in cardiovascular medicine. 2022;9:901990. [Content Brief]
[2]. Makwana R, et al. Copeptin, a surrogate marker of arginine vasopressin, has no ability to modulate human and mouse gastric motility. European journal of pharmacology. 2021 Feb 05;892:173740. [Content Brief]
[3]. Morgenthaler NG, et al. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. Clinical chemistry. 2006 Jan;52(1):112-9. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Copeptin (human) acetate Related Classifications
HY-P5007A Related Classifications
Powered by Bioz