Copeptin (human)
Copeptin (human) is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers.
For research use only. We do not sell to patients.
- CAS No.: 78362-34-2
- Formula: C177H279N49O58
- Molecular Weight:4021.40
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Copeptin (1-100 nM) has no effect on the basal tone and spontaneous myogenic contractions of human proximal or distal gastric circular muscle; it has no effect on the basal tone and spontaneous myogenic contractions of isolated distal gastric tissues from mice; and it has no effect on the tension of isolated mouse aortas pre-contracted to submaximal levels[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 78362-34-2
-
Molecular Weight 4021.40
-
Formula C177H279N49O58
-
Sequence
Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr
-
Sequence Shortening
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Frontiers in cardiovascular medicine. 2022;9:901990. [Content Brief]
[2]. Makwana R, et al. Copeptin, a surrogate marker of arginine vasopressin, has no ability to modulate human and mouse gastric motility. European journal of pharmacology. 2021 Feb 05;892:173740. [Content Brief]
[3]. Morgenthaler NG, et al. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. Clinical chemistry. 2006 Jan;52(1):112-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Copeptin (human) Related Classifications
HY-P5007 Related Classifications
Powered by Bioz