Corza6 TFA
Corza6 TFA is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 TFA binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 TFA allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs).
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C203H293N55O61S7.xC2HF3O2
- Masse moléculaire:4704.29 (free base)
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
Description
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4704.29 (free base)
-
Formule C203H293N55O61S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Ser-Ser-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Ala-Asp-Ser-Asp-Asp-Cys-Cys-Glu-Thr-Phe-His-Cys-Lys-Trp-Val-Phe-Phe-Thr-Ser-Lys-Phe-Met-Cys-Arg-Arg-Val-Trp-Gly-Lys-Asp (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
-
Sequence Shortening
SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
In Vitro:
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Pureté et documentation
-
Fiche technique (294 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)