country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5857

Copy Link Print Information

MmTx2 toxin

(Synonyms: Micrurotoxin 2)

MmTx2 toxin is a GABA_A receptor modulator that enhances GABA_A receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₂₉₅H₄₅₀N₉₄O₉₇S₁₀
Masse moléculaire:7185.95

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

MmTx2 toxin Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Chemical Information

Masse moléculaire 7185.95
Formule C₂₉₅H₄₅₀N₉₄O₉₇S₁₀
Synonyms

Micrurotoxin 2
Sequence

Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-His-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Sequence Shortening

LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (261 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Rosso JP, et al. MmTX1 and MmTX2 from coral snake venom potently modulate GABAA receptor activity. Proc Natl Acad Sci U S A. 2015 Feb 24;112(8):E891-900. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtenir un devis En stock