Copeptin (human)
Copeptin (human) is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 78362-34-2
- 화학식: C177H279N49O58
- 분자량:4021.40
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- 순도&문서
- References
-
Help & FAQs
Biological Activity
제품 설명
In Vitro
Copeptin (1-100 nM) has no effect on the basal tone and spontaneous myogenic contractions of human proximal or distal gastric circular muscle; it has no effect on the basal tone and spontaneous myogenic contractions of isolated distal gastric tissues from mice; and it has no effect on the tension of isolated mouse aortas pre-contracted to submaximal levels[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 78362-34-2
-
분자량 4021.40
-
화학식 C177H279N49O58
-
Sequence
Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr
-
Sequence Shortening
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
[1]. Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Frontiers in cardiovascular medicine. 2022;9:901990. [Content Brief]
[2]. Makwana R, et al. Copeptin, a surrogate marker of arginine vasopressin, has no ability to modulate human and mouse gastric motility. European journal of pharmacology. 2021 Feb 05;892:173740. [Content Brief]
[3]. Morgenthaler NG, et al. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. Clinical chemistry. 2006 Jan;52(1):112-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Copeptin (human) Related Classifications
HY-P5007 Related Classifications
Powered by Bioz