pTH (1-84) (dog)
pTH (1-84) dog is a biologically active full-length canine parathyroid hormone, as well as an agonist of PTHR. pTH (1-84) dog can be detected by the "intact" PTH (W-PTH) assay, thus effectively distinguishing inactive C-terminal fragments. In terms of metabolic regulation, it rapidly and persistently stimulates hepatic glucose release, hepatic alanine uptake, and alanine-based gluconeogenesis in conscious fasted dogs, and causes a secondary increase in circulating canine insulin levels due to enhanced glucose release. However, high doses of pTH (1-84) (dog) may induce adverse reactions such as hypercalcemia in dogs. Based on the above characteristics, this hormone can be widely used in studies related to canine hyperadrenocorticism (HAC).
For research use only. We do not sell to patients.
- CAS No.: 521986-14-1
- Formula: C414H672N122O128S2
- Molecular Weight:9470.64
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
pTH (1-84) dog (1/1:1/256) reliably measured by the W-PTH assay in isolated dog plasma samples with accurate detection down to ~5 pg/mL, produces parallel dilution curves with isolated human plasma, and shows high correlation with I-PTH measurements in isolated dog plasma[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
pTH (1-84) dog (measured as W-PTH) is metabolized more rapidly than I-PTH in the first 2.5 minutes after parathyroidectomy, with levels falling to 25% of pre-surgical values[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 521986-14-1
-
Molecular Weight 9470.64
-
Formula C414H672N122O128S2
-
Sequence
Ser-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Ile-Ala-His-Arg-Asp-Gly-Ser-Ser-Gln-Arg-Pro-Leu-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-Tyr-Gln-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asp-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln
-
Sequence Shortening
SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[2]. Estepa J C, et al. Dynamics of secretion and metabolism of PTH during hypo‐and hypercalcaemia in the dog as determined by the ‘intact’and ‘whole’PTH assays[J]. Nephrology Dialysis Transplantation, 2003, 18(6): 1101-1107. [Content Brief]
[3]. Hruska K A, et al. Effect of intact parathyroid hormone on hepatic glucose release in the dog[J]. The Journal of Clinical Investigation, 1979, 64(4): 1016-1023. [Content Brief]
[4]. Nishitani K, et al. High dose teriparatide (rPTH1-34) therapy increases callus volume and enhances radiographic healing at 8-weeks in a massive canine femoral allograft model[J]. PLoS One, 2017, 12(10): e0185446. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz