1. GPCR/G Protein
  2. PTHR
  3. pTH (1-84) (dog)

pTH (1-84) dog is a biologically active full-length canine parathyroid hormone, as well as an agonist of PTHR. pTH (1-84) dog can be detected by the "intact" PTH (W-PTH) assay, thus effectively distinguishing inactive C-terminal fragments. In terms of metabolic regulation, it rapidly and persistently stimulates hepatic glucose release, hepatic alanine uptake, and alanine-based gluconeogenesis in conscious fasted dogs, and causes a secondary increase in circulating canine insulin levels due to enhanced glucose release. However, high doses of pTH (1-84) (dog) may induce adverse reactions such as hypercalcemia in dogs. Based on the above characteristics, this hormone can be widely used in studies related to canine hyperadrenocorticism (HAC).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

pTH (1-84) (dog)

pTH (1-84) (dog) Chemical Structure

CAS No. : 521986-14-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All PTHR Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

pTH (1-84) dog is a biologically active full-length canine parathyroid hormone, as well as an agonist of PTHR. pTH (1-84) dog can be detected by the "intact" PTH (W-PTH) assay, thus effectively distinguishing inactive C-terminal fragments. In terms of metabolic regulation, it rapidly and persistently stimulates hepatic glucose release, hepatic alanine uptake, and alanine-based gluconeogenesis in conscious fasted dogs, and causes a secondary increase in circulating canine insulin levels due to enhanced glucose release. However, high doses of pTH (1-84) (dog) may induce adverse reactions such as hypercalcemia in dogs. Based on the above characteristics, this hormone can be widely used in studies related to canine hyperadrenocorticism (HAC)[1][2][3][4].

In Vitro

pTH (1-84) dog (1/1:1/256) reliably measured by the W-PTH assay in isolated dog plasma samples with accurate detection down to ~5 pg/mL, produces parallel dilution curves with isolated human plasma, and shows high correlation with I-PTH measurements in isolated dog plasma[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

pTH (1-84) dog (measured as W-PTH) increases 4.7-fold from baseline to 62 pg/mL during acute hypocalcaemia, decreases to 5.7 pg/mL during hypercalcaemia, and shows a sustained increase in its ratio to I-PTH during prolonged hypocalcaemia[2].
pTH (1-84) dog (measured as W-PTH) is metabolized more rapidly than I-PTH in the first 2.5 minutes after parathyroidectomy, with levels falling to 25% of pre-surgical values[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

9470.64

Formula

C414H672N122O128S2

CAS No.
Sequence

Ser-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Ile-Ala-His-Arg-Asp-Gly-Ser-Ser-Gln-Arg-Pro-Leu-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-Tyr-Gln-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asp-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln

Sequence Shortening

SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
pTH (1-84) (dog)
Cat. No.:
HY-P4827
Quantity:
MCE Japan Authorized Agent: