1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIA/CD16a Fc gamma RIII/CD16
  5. Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)

Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)

Cat. No.: HY-P75621
Instrucciones de manejo Technical Support

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) is the recombinant rat-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) is the recombinant rat-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His labeled tag.

Background

The Fc γ RIIIA/CD16a protein is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG) and is optimally activated upon binding to the aggregation antigen-igg complex displayed on the cell surface, initiating antibody-dependent cytotoxicity (ADCC). Fc γ RIIIA/CD16a mediates IgG effects on natural killer (NK) cells, binding to antigen-igg complexes produced during infection, triggering NK cell-dependent cytokine production and degranulation. Fc γ RIIIA/CD16a plays a crucial role in the generation of memory-like adaptive NK cells, regulating NK cell survival and proliferation, and preventing NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the antitumor activity of therapeutic antibodies, triggering TNFA-dependent ADCC in IgG-coated tumor cells and enhancing ADCC in response to focused IgG. Fc γ RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism that promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication[1][2][3].

Actividad biológica

Measured by its binding ability in a functional ELISA.Immobilized rat FCGR3A-His at 10 μg/mL (100 μl/well) can bind biotinylated human IgG1, The EC50 of biotinylated human IgG1 is 59.0-139.0 ng/mL.

Species

Rat

Source

HEK293

Tag

C-His

Accession

XP_008767961.1 (L22-P200)

Gene ID
Molecular Construction
N-term
Fc gamma RIIIA/CD16a (L22-P200)
Accession # XP_008767961.1
His
C-term
Protein Length

Partial

Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3
AA Sequence

LQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGDPTSPSSFLP

Peso molecular

28-33 kDa

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)
Cat. No.:
HY-P75621
Cantidad:
MCE Japan Authorized Agent: