Copy Link Print Information

Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) is the recombinant rat-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)
  • Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) is the recombinant rat-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His labeled tag.

Background

The Fc γ RIIIA/CD16a protein is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG) and is optimally activated upon binding to the aggregation antigen-igg complex displayed on the cell surface, initiating antibody-dependent cytotoxicity (ADCC). Fc γ RIIIA/CD16a mediates IgG effects on natural killer (NK) cells, binding to antigen-igg complexes produced during infection, triggering NK cell-dependent cytokine production and degranulation. Fc γ RIIIA/CD16a plays a crucial role in the generation of memory-like adaptive NK cells, regulating NK cell survival and proliferation, and preventing NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the antitumor activity of therapeutic antibodies, triggering TNFA-dependent ADCC in IgG-coated tumor cells and enhancing ADCC in response to focused IgG. Fc γ RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism that promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication[1][2][3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized rat FCGR3A-His at 10 μg/mL (100 μl/well) can bind biotinylated human IgG1, The EC50 of biotinylated human IgG1 is 59.0-139.0 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    XP_008767961.1 (L22-P200)

  • Gene ID
    304966  [NCBI]
  • Molecular Construction
    • N-term
    • Fc gamma RIIIA/CD16a (L22-P200)
      Accession # XP_008767961.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FCGR3A; CD16; Prev. FCGR3; Fc Fragment Of IgG, Low Affinity IIIa, Receptor For (CD16); Prev. FCG3; Fc Of IgG Low Affinity IIIa Receptor Isoform 2; FcgammaRIIIa; Fc Of IgG Low Affinity IIIa Receptor Isoform 1; FcGRIIIA; Immunoglobulin G Fc Receptor III; CD

  • AA Sequence

    LQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGDPTSPSSFLP

  • Predicted Molecular Mass

    21.7 kDa

  • Molecular Weight

    Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution)
  • Fc gamma RIIIA/CD16a Protein, Rat (HEK293, His, solution) Product Image