Copy Link Print Information

CD68 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

CD68 protein is essential for phagocytic activities in tissue macrophages, including lysosomal metabolism and interactions with cells and pathogens. It binds to lectins or selectins, aiding targeted migration of specific macrophage subsets. CD68's rapid recirculation from endosomes and lysosomes to the plasma membrane allows macrophages to crawl or interact with selectin-bearing substrates and other cells. CD68 Protein, Human (sf9, His) is the recombinant human-derived CD68 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • CD68 Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD68 protein is essential for phagocytic activities in tissue macrophages, including lysosomal metabolism and interactions with cells and pathogens. It binds to lectins or selectins, aiding targeted migration of specific macrophage subsets. CD68's rapid recirculation from endosomes and lysosomes to the plasma membrane allows macrophages to crawl or interact with selectin-bearing substrates and other cells. CD68 Protein, Human (sf9, His) is the recombinant human-derived CD68 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

CD68 protein is thought to play a crucial role in various phagocytic activities carried out by tissue macrophages, encompassing intracellular lysosomal metabolism as well as extracellular interactions with cells and pathogens. It has the ability to bind to tissue- and organ-specific lectins or selectins, facilitating the targeted migration of specific macrophage subsets to particular sites. The rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane enables macrophages to crawl over selectin-bearing substrates or interact with other cells.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    P34810 (N22-S319)

  • Gene ID
    968  [NCBI]
  • Molecular Construction
    • N-term
    • CD68 (N22-S319)
      Accession # P34810
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD68; LAMP4; CD68 Molecule; Scavenger Receptor Class D, Member 1; Macrosialin; Macrophage Antigen CD68; CD68 Antigen; DKFZp686M18236; SCARD1; Gp110; GP110

  • AA Sequence

    NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

  • Predicted Molecular Mass

    33 kDa

  • Molecular Weight

    Approximately 68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD68 Protein, Human (sf9, His) Product Image
    1/16
  • CD68 Protein, Human (sf9, His) Product Image