CISD1 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
The CISD1 protein acts as an L-cysteine aminotransferase, mediating the reversible transfer between L-cysteine and 2-oxoglutarate. Facilitated by the pyridoxal 5'-phosphate (PLP) cofactor, this process produces 2-oxo-3-sulfanylpropionate and L-glutamic acid. CISD1 Protein, Human (His) is the recombinant human-derived CISD1 protein, expressed by E. coli , with N-His, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The CISD1 protein acts as an L-cysteine aminotransferase, mediating the reversible transfer between L-cysteine and 2-oxoglutarate. Facilitated by the pyridoxal 5'-phosphate (PLP) cofactor, this process produces 2-oxo-3-sulfanylpropionate and L-glutamic acid. CISD1 Protein, Human (His) is the recombinant human-derived CISD1 protein, expressed by E. coli , with N-His, N-6*His labeled tag.
The CISD1 protein functions as an L-cysteine transaminase, facilitating the reversible transfer of the amino group from L-cysteine to the alpha-keto acid 2-oxoglutarate. This enzymatic process results in the formation of 2-oxo-3-sulfanylpropanoate and L-glutamate. The catalytic cycle is orchestrated in the presence of the pyridoxal 5'-phosphate (PLP) cofactor, which initiates transamination by forming an internal aldimine with the epsilon-amino group of the active site Lys-55 residue on the enzyme (PLP-enzyme aldimine). This internal aldimine is subsequently displaced by the formation of an external aldimine with the substrate amino group (PLP-L-cysteine aldimine). The external aldimine undergoes deprotonation, leading to the formation of a carbanion intermediate. In the presence of 2-oxoglutarate, this intermediate regenerates PLP, ultimately yielding the final products 2-oxo-3-sulfanylpropanoate and L-glutamate. The active site lysine residue is implicated in controlling proton transfer in the carbanion intermediate, while PLP stabilizes the carbanion structure through electron delocalization, a phenomenon known as the electron sink effect. Additionally, CISD1 plays a crucial role in regulating the maximal capacity for electron transport and oxidative phosphorylation and may be involved in iron-sulfur cluster shuttling and/or redox reactions. Notably, it can transfer the [2Fe-2S] cluster to an apo-acceptor protein, particularly under oxidative stress conditions, suggesting a role as a redox sensor that regulates mitochondrial iron-sulfur cluster assembly and iron trafficking.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
Xanthatin Targets CISD1 to Drive Ferroptosis and Mitophagy as a Dual Anticancer Strategy in Triple-Negative Breast Cancer. [Abstract]2026 Apr;13(21):e20051. PMID: 41646014
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NZ45/NP_060934.1 (K32-T108)
-
Molecular Construction
-
N-term
-
6*His
-
CISD1 (K32-T108)
Accession # Q9NZ45/NP_060934.1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
CISD1; CDGSH Iron-Sulfur Domain-Containing Protein 1; Prev. C10orf70; Chromosome 10 Open Reading Frame 70; Prev. ZCD1; Zinc Finger, CDGSH-Type Domain 1; MitoNEET; Zinc Finger CDGSH-Type Domain 1; MDS029; CDGSH Iron Sulfur Domain 1; Cysteine Transaminase C
-
AA Sequence
KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)