FcgR4/CD16-2 Protein, Mouse (HEK293, His-Avi)

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The FcγR4/CD16-2 Protein serves as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), exhibiting intermediate affinity for both IgG2a and IgG2b. It recognizes neutralizing virus-specific IgGs on infected cells, triggering antibody-dependent cellular cytotoxicity (ADCC) and conferring protection against lethal influenza virus infection. On splenic dendritic cells, FcγR4 efficiently uptakes antigen immune complexes, directing them into MHC class I and II antigen presentation pathways, thereby enhancing CD4-positive and CD8-positive T cell immune responses. Additionally, FcγR4 plays a crucial role in mediating neutrophil activation by IgG complexes, acting redundantly with FCGR2A. It contributes to bone resorption by enhancing osteoclast differentiation upon binding to IgG2a. Furthermore, FcγR4 functions as a receptor for the Fc region of immunoglobulin epsilon (IgE), binding to both a and b allotypes of IgE and promoting macrophage-mediated phagocytosis, antigen presentation to T cells, and the late phase of cutaneous allergic reactions. It forms a heterooligomeric complex with ITAM-containing signaling subunits FCER1G and interacts with the Fc region of antigen-complexed IgG.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FcgR4 (Q19-Q203)
      Accession # A0A0B4J1G0
    • Avi-His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; CD16-2; FcgammaRIV; CD16a; Fcgr4; Fcgr3a

  • AA Sequence

    QAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ

  • Predicted Molecular Mass

    24.2 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00