LAP3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The LAP3 protein is a cytosolic metallopeptidase that serves as a catalytic entity responsible for the removal of unsubstituted N-terminal hydrophobic amino acids from a variety of peptides. The peptidase activity of LAP3 depends on the presence of Zn(2+) ions, and its substrate specificity can be modulated by binding to other cofactors. LAP3 Protein, Human (HEK293, His) is the recombinant human-derived LAP3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The LAP3 protein is a cytosolic metallopeptidase that serves as a catalytic entity responsible for the removal of unsubstituted N-terminal hydrophobic amino acids from a variety of peptides. The peptidase activity of LAP3 depends on the presence of Zn(2+) ions, and its substrate specificity can be modulated by binding to other cofactors. LAP3 Protein, Human (HEK293, His) is the recombinant human-derived LAP3 protein, expressed by HEK293 , with C-His labeled tag.
Leucine aminopeptidase 3 (LAP3) is a cytosolic metallopeptidase crucial for catalyzing the removal of unsubstituted N-terminal hydrophobic amino acids from various peptides. The enzymatic activity of LAP3 is contingent upon the presence of Zn(2+) ions, and the association with other cofactors can modulate its substrate specificity. In the presence of Mn(2+), LAP3 exhibits a specific Cys-Gly hydrolyzing activity, targeting Cys-Gly-S-conjugates. This peptidase is notably involved in the metabolism of glutathione and the degradation of glutathione S-conjugates, suggesting a role in regulating the cellular redox status. The diverse substrate specificity and involvement in cellular processes underscore the significance of LAP3 in peptide metabolism and cellular redox control.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P28838/NP_056991.2 (M1-A519)
-
Molecular Construction
-
N-term
-
LAP3 (M1-A519)
Accession # P28838/NP_056991.2 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LAP3; Cytosol Aminopeptidase; Prev. PEPS; Leucyl Aminopeptidase; LAPEP; Prolyl Aminopeptidase; Peptidase S; Epididymis Secretory Protein Li 106; LAP; HEL-S-106; Cysteinylglycine-S-Conjugate Dipeptidase; LAP-3; Leucine Aminopeptidase 3; Proline Aminopeptid
-
AA Sequence
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
-
Predicted Molecular Mass
57.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 20% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
