1. Recombinant Proteins
  2. Enzymes & Regulators
  3. LAP3 Protein, Human (HEK293, His)

The LAP3 protein is a cytosolic metallopeptidase that serves as a catalytic entity responsible for the removal of unsubstituted N-terminal hydrophobic amino acids from a variety of peptides. The peptidase activity of LAP3 depends on the presence of Zn(2+) ions, and its substrate specificity can be modulated by binding to other cofactors. LAP3 Protein, Human (HEK293, His) is the recombinant human-derived LAP3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAP3 protein is a cytosolic metallopeptidase that serves as a catalytic entity responsible for the removal of unsubstituted N-terminal hydrophobic amino acids from a variety of peptides. The peptidase activity of LAP3 depends on the presence of Zn(2+) ions, and its substrate specificity can be modulated by binding to other cofactors. LAP3 Protein, Human (HEK293, His) is the recombinant human-derived LAP3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Leucine aminopeptidase 3 (LAP3) is a cytosolic metallopeptidase crucial for catalyzing the removal of unsubstituted N-terminal hydrophobic amino acids from various peptides. The enzymatic activity of LAP3 is contingent upon the presence of Zn(2+) ions, and the association with other cofactors can modulate its substrate specificity. In the presence of Mn(2+), LAP3 exhibits a specific Cys-Gly hydrolyzing activity, targeting Cys-Gly-S-conjugates. This peptidase is notably involved in the metabolism of glutathione and the degradation of glutathione S-conjugates, suggesting a role in regulating the cellular redox status. The diverse substrate specificity and involvement in cellular processes underscore the significance of LAP3 in peptide metabolism and cellular redox control.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-His

Accession

P28838/NP_056991.2 (M1-A519)

Gene ID
Molecular Construction
N-term
LAP3 (M1-A519)
Accession # P28838/NP_056991.2
His
C-term
Protein Length

Full Length

Synonyms
Cytosol aminopeptidase; LAP-3; Peptidase S; LAP3; LAPEP; PEPS
AA Sequence

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA

Predicted Molecular Mass
57.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 20% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LAP3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LAP3 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAP3 Protein, Human (HEK293, His)
Cat. No.:
HY-P74780
Quantity:
MCE Japan Authorized Agent: