MARCH2 Protein, Human (Cell-Free, His, SUMO)
The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.
MARCH2, an E3 ubiquitin-protein ligase, orchestrates diverse cellular processes by mediating the ubiquitination and subsequent endocytosis of various substrates. It is implicated in the ubiquitination and lysosomal degradation of transferrin receptor (TFRC) and CD86, suggesting a role in regulating their cellular levels. Collaborating with GOPC/CAL, MARCH2 participates in the ubiquitination and lysosomal degradation of CFTR. Additionally, it regulates the intracellular trafficking and secretion of alpha1-antitrypsin/SERPINA1 and haptoglobin/HP by ubiquitinating and promoting the degradation of the cargo receptor ERGIC3. MARCH2 negatively modulates antiviral and antibacterial immune responses by repressing NF-kB and type 1 interferon signaling pathways through K48-linked polyubiquitination of IKBKG/NEMO. Moreover, its involvement in endosomal trafficking is indicated by its interaction with STX6. In the context of microbial infection, MARCH2 positively influences the degradation of the Vesicular stomatitis virus (VSV) G protein via the lysosomal degradation pathway, and it represses HIV-1 viral production, potentially impeding the translocation of HIV-1 env to the cell surface and reducing viral cell-cell transmission.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-6*His;N-SUMO
-
Accession
Q9P0N8 (M1-V246)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
MARCH2 (M1-V246)
Accession # Q9P0N8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MARCHF2; Membrane-Associated RING Finger Protein 2; Prev. MARCH2; Ring Finger Protein 172; MARCH-II; Membrane-Associated Ring Finger (C3HC4) 2; RNF172; RING-Type E3 Ubiquitin Transferase MARCH2; E3 Ubiquitin-Protein Ligase MARCHF2; E3 Ubiquitin-Protein Li
-
AA Sequence
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
-
Predicted Molecular Mass
43 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
