Osteocrin Protein, Human (His)
Based on 1 Customer Validation
Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.
Osteocrin protein serves as a crucial regulator of dendritic growth in the developing cerebral cortex, responding to sensory experience. It is induced in the brain upon membrane depolarization and works to inhibit dendritic branching in neurons of the developing cortex. This protein likely achieves its effects by binding to the natriuretic peptide receptor NPR3/NPR-C, thereby preventing the interaction between NPR3/NPR-C and natriuretic peptides, ultimately resulting in increased cproduction. Additionally, Osteocrin interacts with NPR3, further modulating its activity in dendritic growth regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P61366 (V28-G133)
-
Molecular Construction
-
N-term
-
6*His
-
Osteocrin (V28-G133)
Accession # P61366 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OSTN; MUSCLIN; Osteocrin; Musclin
-
AA Sequence
VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
