PAK4 Protein, Human (GST)
PAK4 is an important serine/threonine kinase that affects cytoskeletal regulation, cell migration, growth, and survival through multiple pathways. Activation triggered by various effectors induces autophosphorylation, targeting proteins such as SSH1 and LIMK1 to regulate cofilin activity and stabilize actin filaments. PAK4, Human (GST) is the recombinant human-derived PAK4 protein, expressed by E. coli, with labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
PAK4 is an important serine/threonine kinase that affects cytoskeletal regulation, cell migration, growth, and survival through multiple pathways. Activation triggered by various effectors induces autophosphorylation, targeting proteins such as SSH1 and LIMK1 to regulate cofilin activity and stabilize actin filaments. PAK4, Human (GST) is the recombinant human-derived PAK4 protein, expressed by E. coli, with labeled tag.
PAK4, a serine/threonine protein kinase, exerts its influence across diverse signaling pathways, impacting cytoskeleton regulation, cell migration, growth, proliferation, and cell survival. Activation triggered by various effectors, such as growth factor receptors or active CDC42 and RAC1, induces a conformational change and subsequent autophosphorylation on multiple serine and/or threonine residues. PAK4's phosphorylation targets include the protein phosphatase SSH1, leading to increased inhibitory phosphorylation of the actin binding/depolymerizing factor cofilin. This results in decreased cofilin activity, promoting the stabilization of actin filaments. Additionally, PAK4 phosphorylates LIMK1, another kinase that inhibits cofilin activity. By phosphorylating integrin beta5/ITGB5, PAK4 regulates cell motility, while its phosphorylation of ARHGEF2 activates the downstream target RHOA, contributing to the regulation of focal adhesion assembly and actin stress fibers. PAK4 plays a crucial role in cell survival by phosphorylating the BCL2 antagonist of cell death, BAD. Alternatively, it inhibits apoptosis by preventing the binding of caspase-8 to death domain receptors, acting in a kinase-independent manner. Furthermore, PAK4 influences cell-cycle progression by controlling the levels of the cell-cycle regulatory protein CDKN1A and by phosphorylating RAN.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O96013-1 (S291-R591)
-
Gene ID10298
-
Molecular Construction
-
N-term
-
GST
-
PAK4 (S291-R591)
Accession # O96013-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PAK4; Protein Kinase Related To S. Cerevisiae STE20, Effector For Cdc42Hs; P21 (RAC1) Activated Kinase 4; Non-Specific Serine/Threonine Protein Kinase; P21 Protein (Cdc42/Rac)-Activated Kinase 4; P21-Activated Kinase 4; Serine/Threonine-Protein Kinase PAK
-
AA Sequence
SPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)