SULT1E1 Protein, Human (His, solution)
Based on 1 Customer Validation
The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (His, solution) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (His, solution) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.
SULT1E1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor, plays a pivotal role in estrogen homeostasis by catalyzing the sulfate conjugation of estradiol and estrone, contributing to the inactivation of these hormones. Beyond its primary function in estrogen metabolism, SULT1E1 demonstrates versatility by sulfating dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol, and various xenobiotic compounds such as ethinylestradiol, equalenin, diethyl stilbesterol, and 1-naphthol, albeit with lower efficiency. Notably, SULT1E1 does not sulfonate cortisol, testosterone, and dopamine. Moreover, this sulfotransferase may be implicated in gut microbiota-host metabolic interactions, as it O-sulfonates 4-ethylphenol (4-EP), a tyrosine-derived metabolite produced by gut bacteria. The resulting product, 4-EPS, crosses the blood-brain barrier and potentially exerts regulatory effects on oligodendrocyte maturation and myelination, influencing the functional connectivity of brain regions associated with the limbic system. The diverse substrate specificity of SULT1E1 highlights its crucial role in hormonal regulation and suggests its involvement in broader physiological processes, including gut-brain interactions with potential implications for neurological functions.
Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 73.64 pmol/min/μg, as measured under the described conditions.
Assay Procedure
Materials
1-Napthol, 10 mM dissolved in ethanol
3'-Phosphoadenosine-5'-phosphosulfate
Universal Sulfotransferase Activity Kit
SULT1E1 Protein, Human (His)(HY-P76099)
50 mM Tris, 15 mM MgCl2, pH 7.5 (supplied in the kit)
Procedure
1. Dilute the 10× buffer in the kit to 1× buffer.
2. Dilute the standard to 5000, 2500, 1250, 625, 313, 156, 78, 0 pmol.
3. A reaction mixture containing 0.4 mM PAPS, 0.4 mM 1-naphthol and 0.02 mg/mL of coupled phosphatase 3 was prepared with 1× buffer.
4. Dilute the proteins to be measured to 20 μg/mL.
5. Add the standard curve at 50 μL per well to a 96-well plate and add 50 μL of 1× buffer as blank wells.
6. Add 25 μL of Human SULT1E1 to the plate and 25 μL of 1× buffer as blank wells.
7. Add 25 μL of reaction mixture to the wells, excluding the standard curve wells.
8. Seal the plate and incubate at 37 °C for 20 minutes.
9. Add 30 μL Malachite Green Reagent A to all wells and mix.
10. Add 100 μL of deionized water to all wells and mix.
11. Add 30 μL of Malachite Green Reagent B to all wells and mix, incubate for 20 minutes at room temperature.
12. Read at 620 nm on the microplate reader.
13. Calculate specific activity:
Specific Activity (pmol/min/μg) = | Phosphate released * (nmol) x (1000 pmol/nmol) |
| Incubation time (min) x amount of enzyme (μg) |
*Derived from the phosphate standard curve via linear regression and corrected for control.
Per Well:
Human SULT1E1: 0.5 μg
PAPS: 0.2 mM
1-Napthol: 0.2 mM
Coupling Phosphatase 3: 0.01 mg/mL
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P49888 (N2-I294)
-
Molecular Construction
-
N-term
-
His
-
SULT1E1 (N2-I294)
Accession # P49888 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SULT1E1; Estrogen Sulfotransferase; Prev. STE; EST-1; Sulfotransferase, Estrogen-Preferring; ST1E1; EST; Estrone Sulfotransferase; Sulfotransferase Family 1E, Estrogen-Preferring, Member 1; Sulfotransferase; Sulfotransferase Family 1E Member 1; Sulfotrans
-
AA Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris 0.5 M NaCl, 20% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)