1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1E1 Protein, Human (His, solution)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (His, solution) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg Get quote
50 μg Get quote
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (His, solution) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Background

SULT1E1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor, plays a pivotal role in estrogen homeostasis by catalyzing the sulfate conjugation of estradiol and estrone, contributing to the inactivation of these hormones. Beyond its primary function in estrogen metabolism, SULT1E1 demonstrates versatility by sulfating dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol, and various xenobiotic compounds such as ethinylestradiol, equalenin, diethyl stilbesterol, and 1-naphthol, albeit with lower efficiency. Notably, SULT1E1 does not sulfonate cortisol, testosterone, and dopamine. Moreover, this sulfotransferase may be implicated in gut microbiota-host metabolic interactions, as it O-sulfonates 4-ethylphenol (4-EP), a tyrosine-derived metabolite produced by gut bacteria. The resulting product, 4-EPS, crosses the blood-brain barrier and potentially exerts regulatory effects on oligodendrocyte maturation and myelination, influencing the functional connectivity of brain regions associated with the limbic system. The diverse substrate specificity of SULT1E1 highlights its crucial role in hormonal regulation and suggests its involvement in broader physiological processes, including gut-brain interactions with potential implications for neurological functions.

Biological Activity

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 73.64 pmol/min/μg, as measured under the described conditions.

Assay Procedure

Materials
1-Napthol, 10 mM dissolved in ethanol
3'-Phosphoadenosine-5'-phosphosulfate
Universal Sulfotransferase Activity Kit
SULT1E1 Protein, Human (His)(HY-P76099)
50 mM Tris, 15 mM MgCl2, pH 7.5 (supplied in the kit)

Procedure
1. Dilute the 10× buffer in the kit to 1× buffer.
2. Dilute the standard to 5000, 2500, 1250, 625, 313, 156, 78, 0 pmol.
3. A reaction mixture containing 0.4 mM PAPS, 0.4 mM 1-naphthol and 0.02 mg/mL of coupled phosphatase 3 was prepared with 1× buffer.
4. Dilute the proteins to be measured to 20 μg/mL.
5. Add the standard curve at 50 μL per well to a 96-well plate and add 50 μL of 1× buffer as blank wells.
6. Add 25 μL of Human SULT1E1 to the plate and 25 μL of 1× buffer as blank wells.
7. Add 25 μL of reaction mixture to the wells, excluding the standard curve wells.
8. Seal the plate and incubate at 37 °C for 20 minutes.
9. Add 30 μL Malachite Green Reagent A to all wells and mix.
10. Add 100 μL of deionized water to all wells and mix.
11. Add 30 μL of Malachite Green Reagent B to all wells and mix, incubate for 20 minutes at room temperature.
12. Read at 620 nm on the microplate reader.
13. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Phosphate released * (nmol) x (1000 pmol/nmol)
Incubation time (min) x amount of enzyme (μg)

*Derived from the phosphate standard curve via linear regression and corrected for control.

Per Well:
Human SULT1E1: 0.5 μg
PAPS: 0.2 mM
1-Napthol: 0.2 mM
Coupling Phosphatase 3: 0.01 mg/mL

Species

Human

Source

E. coli

Tag

N-His

Accession

P49888 (N2-I294)

Gene ID
Molecular Construction
N-term
His
SULT1E1 (N2-I294)
Accession # P49888
C-term
Protein Length

Partial

Synonyms
Sulfotransferase 1E1; ST1E1; EST-1; Estrogen sulfotransferase; STE
AA Sequence

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Predicted Molecular Mass
36 kDa
Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris 0.5 M NaCl, 20% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SULT1E1 Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SULT1E1 Protein, Human (His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1E1 Protein, Human (His, solution)
Cat. No.:
HY-P76099
Quantity:
MCE Japan Authorized Agent: