TEC Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
TEC proteins are dynamic nonreceptor tyrosine kinases that transduce signals in a variety of cellular processes. In adaptive immunity, TEC regulate T cell development, affecting IL2 gene induction and CD28 signaling. TEC Protein, Human (sf9, GST) is the recombinant human-derived TEC protein, expressed by sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TEC proteins are dynamic nonreceptor tyrosine kinases that transduce signals in a variety of cellular processes. In adaptive immunity, TEC regulate T cell development, affecting IL2 gene induction and CD28 signaling. TEC Protein, Human (sf9, GST) is the recombinant human-derived TEC protein, expressed by sf9 insect cells , with N-GST labeled tag.
TEC protein, a non-receptor tyrosine kinase, serves as a versatile signal transducer in various cellular processes. Crucial in adaptive immunity, TEC regulates T-cell development, function, and differentiation, impacting IL2 gene induction and CD28 signaling. It collaborates with ITK and BTK in T-cell and B-cell responses, respectively, influencing BCR signaling and cytokine production in mast cells. Additionally, TEC plays a role in myeloid cell growth and differentiation through CSF3 activation, participates in platelet signaling, and cooperates with JAK2 in FOS transcription activation. Notably, TEC is implicated in hepatocyte proliferation, liver regeneration, and regulates FGF2 secretion through unconventional pathways. Its involvement in G protein-coupled receptor and integrin-mediated signaling in platelets, along with a potential role in osteoclast differentiation, underscores the multifaceted contributions of TEC to diverse cellular mechanisms.
The activity of TEC is verified by the ADP-Glo method: Incubate TEC protein, ATP, and the substrate at room temperature for 40 minutes, then add the ADP-Glo reagent and read the luminescence signal using the chemiluminescence module of the microplate reader.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
P42680 (N2-R631)
-
Gene ID7006
-
Molecular Construction
-
N-term
-
GST
-
TEC (N2-R631)
Accession # P42680 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TEC; PSCTK4; Tec Protein Tyrosine Kinase; Tyrosine-Protein Kinase Tec
-
AA Sequence
NFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
-
Molecular Weight
Approximately 90-100 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT, 0.1 M trehalose.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
