Search Result

Results for "

mimicking

" in MedChemExpress (MCE) Product Catalog:

By Targets:	5-HT Receptor (1) Amine N-methyltransferase (1) Apoptosis (3) Autophagy (1) Bacterial (2) Bcl-2 Family (1) Biochemical Assay Reagents (98) Calcium Channel (1) CGRP Receptor (1) COX (1) Drug Intermediate (1) Drug Metabolite (1) E1/E2/E3 Enzyme (1) EGFR (1) Endogenous Metabolite (5) Estrogen Receptor/ERR (2) Fluorescent Dye (3) FOXO (2) GHSR (1) GLP Receptor (1) Glucosylceramide Synthase (GCS) (2) Herbicide (1) HIV (1) HPV (1) iGluR (3) Insulin Receptor (2) Integrin (1) Isotope-Labeled Compounds (1) Keap1-Nrf2 (1) Liposome (5) Melanocortin Receptor (2) Microtubule/Tubulin (2) Molecular Glues (1) nAChR (1) Neuropeptide Y Receptor (1) NF-κB (2) Nuclear Factor of activated T Cells (NFAT) (1) Nucleoside Antimetabolite/Analog (1) Parasite (1) PDI (1) Peptide-Drug Conjugates (PDCs) (1) Phosphatase (1) Phytohormone (1) PKA (1) Proton Pump (1) Ras (1) Reference Standards (4) SOD (1) Sodium Channel (2) Somatostatin Receptor (2) Thrombin (1) TNF Receptor (2) TRP Channel (1) VEGFR (1) Wnt (3)
By Research Areas:	Cancer (11) Cardiovascular Disease (2) Endocrinology (4) Infection (5) Inflammation/Immunology (4) Metabolic Disease (15) Neurological Disease (17)
Oligonucleotides:	Adenosine (1) Nucleoside Analogs (1) Phospholipids (2)

156

Inhibitors & Agonists

Fluorescent Dyes

102

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Oligonucleotides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-17551

NMDA 25+ Cited Publications N-Methyl-D-aspartic acid	iGluR Endogenous Metabolite	Neurological Disease
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

HY-112416

AZD4320 5 Publications Verification	Bcl-2 Family	Cancer
AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC₅₀s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.

HY-N11420

Coronatine	Bacterial Phytohormone	Others
Coronatine is a plant growth regulator that mimicks the jasmonic acid-isoleucine conjugate (JA-Ile), targets the jasmonic acid receptor COI1, activates the jasmonic acid signaling pathway, thereby inhibiting salicylic acid (SA)-dependent defense responses. Coronatine antagonizes the stomatal closure, induces plant cell necrosis and chlorosis, interfers with plant hormone balance, thereby promoting pathogen infection .

HY-P1416

Foxy-5 Maximum Cited Publications 7 Publications Verification	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P0102

Dipeptide diaminobutyroyl benzylamide diacetate	nAChR	Neurological Disease Metabolic Disease
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a nAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate mimics Waglerin-1 to block neuromuscular junction nicotinic acetylcholine receptors, partially inhibits neuronal signal transduction, and relaxes muscles. Dipeptide diaminobutyroyl benzylamide diacetate reduces appearance of facial wrinkles linked to repeated muscle movement.Dipeptide diaminobutyroyl benzylamide diacetate can be used for the research of mild-to-moderate fine and coarse periocular and perioral wrinkles and periorbital ageing .

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Neurological Disease
KLTWQELYQLKYKGI is a VEGF mimetic peptide designed based on the VEGF helix sequence 17-25, with the ability to activate VEGF receptors and exert pro-angiogenic biological activity. KLTWQELYQLKYKGI effectively promotes the attachment, spreading and proliferation of human umbilical vein endothelial cells. KLTWQELYQLKYKGI enhances the proliferation, migration and osteogenic differentiation of bone marrow stromal cells (BMSCs). KLTWQELYQLKYKGI synergistically accelerates angiogenesis and bone regeneration in rat cranial defect models. KLTWQELYQLKYKGI can be used for the research of brain tissue engineering and traumatic brain injury repair and biomaterials for bone tissue engineering and bone repair .

HY-P10026

Nisotirostide LY-3457263	Neuropeptide Y Receptor	Metabolic Disease
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .

HY-P1416A

Foxy-5 TFA Maximum Cited Publications 7 Publications Verification	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-W250145

Acid Black 2 Nigrosine	Biochemical Assay Reagents	Others
Acid Black 2 (Nigrosine) is an alcohol-soluble absorber used to mimic skin pigmentation in tissue-mimicking phantoms. Acid Black 2 acts as an absorber in silicone-based thin tissue phantoms to simulate varying melanosome volume fractions in skin .

HY-158482

M3 glycan (Man3) Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan	Biochemical Assay Reagents	Others
M3 glycan (Man3) (Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-W142596

1,2-DImyristoyl-rac-glycero-3-phosphocholine	Liposome	Others
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .

HY-162467

Opabactin	Proton Pump	Others
Opabactin is an agonist for abscisic acid (ABA) receptor, which regulates the water use of plants by mimicking the effects of ABA with an IC₅₀ of 7 nM. Opabactin inhibits the seed germination of Arabidopsis with an IC₅₀ of 62 nM. Opabactin induces anti-transpiration response in plant tissue, and improves crop drought tolerance .

HY-D2361

Adenosine 2'-PEG-Biotin	Nucleoside Antimetabolite/Analog	Others
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .

HY-P11430

UBI (31-38)	Biochemical Assay Reagents	Infection
UBI (31-38) is a Ubiquicidin-derived octapeptide and anti-bacterial agent. UBI (31-38) selectively interacts with anionic phospholipid membranes and restricts lipid lateral motion. UBI (31-38) induces anionic vesicle aggregation via electrostatic repulsion screening, and undergoes conformational changes in membrane-mimicking environments. UBI (31-38) can be used for the research of infection imaging probes .

HY-125382

L-797591	Somatostatin Receptor	Metabolic Disease
L-797591 is a selective sst₁ agonist. L-797591 mimicks the effects of SRIF-14 and SRIF-28 by potently inhibiting either Forskolin (HY-15371)-stimulated or CRH-stimulated cAMP accumulation .

HY-P10428

*E6AP-mimicking* peptide**	HPV	Infection
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a K_i of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .

HY-P5171

MDGCEL	Wnt	Cancer
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .

HY-125382A

L-797591 hydrochloride	Somatostatin Receptor	Neurological Disease
L-797591 hydrochloride is a selective sst₁ agonist. L-797591 hydrochloride mimicks the effects of SRIF-14 and SRIF-28 by potently inhibiting either Forskolin (HY-15371)-stimulated or CRH-stimulated cAMP accumulation .

HY-158485

M5 glycan (Man5) Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan	Biochemical Assay Reagents	Others
M5 glycan (Man5) (Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158543

M9 glycan (Man9) Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan	Biochemical Assay Reagents	Others
M9 glycan (Man9) (Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158452

A3G3 glycan (G3) A3G3 N-linked oligosaccharide; A3G(4)3 glycan	Biochemical Assay Reagents	Others
A3G3 glycan (G3) (A3G3 N-linked oligosaccharide; A3G(4)3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158442

A2G2 glycan (G2) A2G2 N-linked oligosaccharide; A2G(4)2 glycan	Biochemical Assay Reagents	Others
A2G2 glycan (G2) (A2G2 N-linked oligosaccharide; A2G(4)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158448

FA2G2 glycan (G2F) FA2G2 N-linked oligosaccharide; F(6)A2G2	Biochemical Assay Reagents	Others
FA2G2 glycan (G2F) (FA2G2 N-linked oligosaccharide; F(6)A2G2) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-P11204

DDDEEKC	Peptide-Drug Conjugates (PDCs)	Others
DDDEEKC is a bioinspired peptide sequence that can selectively adsorb onto the enamel surface (mimicking the role of salivary acquired pellicle protein statherin), acting as a "target - guiding agent" for tooth enamel remineralization. DDDEEKC enhances the regeneration of hydroxyapatite (HAP). DDDEEKC is promising for research of in-situ remineralization repair of enamel demineralization damage (such as dental caries) .

HY-134263

8-Br-cAMP-AM	PKA Ras	Cardiovascular Disease
8-Br-cAMP-AM is a cyclic adenosine monophosphate (cAMP) analog that activates two major signal transduction pathways in the heart by mimicking the effects of cAMP: protein kinase A (PKA) and guanosine nucleotide exchange factor (Epac), which is directly activated by cAMP. 8-Br-cAMP-AM can be used to study cardiac ischemia and reperfusion injury .

HY-P10356

T100-Mut	TRP Channel	Others
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .

HY-167815

myo-Inositol hexasulfate hexapotassium	Biochemical Assay Reagents
Myo-Inositol hexasulfate hexapotassium is a sulfated derivative of inositol that has the activity of mimicking highly sulfated polysaccharides such as heparin, affecting many cell signaling pathways.

HY-158464

Fetuin glycoprotein	Biochemical Assay Reagents	Others
Fetuin glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158466

Human IgG Glycoprotein	Biochemical Assay Reagents	Others
Human IgG Glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158532

A4 glycan A4 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A4 glycan (A4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158528

A3 glycan A3 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A3 glycan (A3 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158460

Alpha-Gal Galactose-alpha-1,3-galactose	Biochemical Assay Reagents	Others
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158490

A4G4 glycan A4G4 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A4G4 glycan (A4G4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158531

A3 glycan, procainamide labelled A3 N-linked oligosaccharide, procainamide labelled	Fluorescent Dye Biochemical Assay Reagents	Others
A3 glycan, procainamide labelled (A3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158472

Sialylated Core 1 O-glycan (C1S(3)1)	Biochemical Assay Reagents	Others
Sialylated Core 1 O-glycan (C1S(3)1) () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158463

A2G2S2-KVANKT glycopeptide	Biochemical Assay Reagents	Others
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158534

M8 glycan (Man8) Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan	Biochemical Assay Reagents	Others
M8 glycan (Man8) (Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158519

M7 glycan (Man7) Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan	Biochemical Assay Reagents	Others
M7 glycan (Man7) (Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158509

M6 glycan (Man6) Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan	Biochemical Assay Reagents	Others
M6 glycan (Man6) (Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-119274

BN-82451 dihydrochloride	COX Sodium Channel	Neurological Disease
BN-82451 dihydrochloride, an orally active and CNS-penetrated antioxidant and a multitargeting neuroprotective agent, exert a significant protection in experimental animal models mimicking aspects of cerebral ischemia, Parkinson disease, Huntington disease, and more particularly amyotrophic lateral sclerosis .

HY-158541

A4 glycan, 2-AB labelled A4 N-linked oligosaccharide, 2-AB labelled	Fluorescent Dye Biochemical Assay Reagents	Others
A4 glycan, 2-AB labelled (A4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158540

A4 glycan, 2-AA labelled A4 N-linked oligosaccharide, 2-AA labelled	Biochemical Assay Reagents	Others
A4 glycan, 2-AA labelled (A4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158468

Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled	Biochemical Assay Reagents	Others
Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158496

A2 glycan (G0), 2-AB labelled A2 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents	Others
A2 glycan (G0), 2-AB labelled (A2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158446

A2G2 glycan (G2), APTS labelled A2G2 N-linked oligosaccharide, APTS labelled	Biochemical Assay Reagents	Others
A2G2 glycan (G2), APTS labelled (A2G2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158461

Alpha-Gal standard, 2-AA labelled Galactose-alpha-1,3-galactose, 2-AA labelled	Biochemical Assay Reagents	Others
Alpha-Gal standard, 2-AA labelled (Galactose-alpha-1,3-galactose, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158462

Alpha-Gal standard, 2-AB labelled Galactose-alpha-1,3-galactose, 2-AB labelled	Biochemical Assay Reagents	Others
Alpha-Gal standard, 2-AB labelled (Galactose-alpha-1,3-galactose, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158492

A4G4 glycan, 2-AB labelled A4G4 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents	Others
A4G4 glycan, 2-AB labelled (A4G4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158537

A3G3S3 glycan, procainamide labelled A3G3S3 N-linked oligosaccharide, procainamide labelled	Biochemical Assay Reagents	Others
A3G3S3 glycan, procainamide labelled (A3G3S3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158507

M5 glycan (Man5), procainamide labelled Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled	Biochemical Assay Reagents	Others
M5 glycan (Man5), procainamide labelled (Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

Cat. No.	Product Name	Type

HY-W250145

Acid Black 2 Nigrosine	Fluorescent Dyes
Acid Black 2 (Nigrosine) is an alcohol-soluble absorber used to mimic skin pigmentation in tissue-mimicking phantoms. Acid Black 2 acts as an absorber in silicone-based thin tissue phantoms to simulate varying melanosome volume fractions in skin .

HY-D2361

Adenosine 2'-PEG-Biotin	Fluorescent Dyes
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .

Cat. No.	Product Name	Target	Research Area

HY-N2466

Melanotan I 1 Publications Verification MT-I; [Nle4,D-Phe7]-α-MSH	Melanocortin Receptor	Neurological Disease Cancer
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .

HY-P1416

Foxy-5 Maximum Cited Publications 7 Publications Verification	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P0102

Dipeptide diaminobutyroyl benzylamide diacetate	nAChR	Neurological Disease Metabolic Disease
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a nAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate mimics Waglerin-1 to block neuromuscular junction nicotinic acetylcholine receptors, partially inhibits neuronal signal transduction, and relaxes muscles. Dipeptide diaminobutyroyl benzylamide diacetate reduces appearance of facial wrinkles linked to repeated muscle movement.Dipeptide diaminobutyroyl benzylamide diacetate can be used for the research of mild-to-moderate fine and coarse periocular and perioral wrinkles and periorbital ageing .

HY-P4198

Fmoc-N(Me)-Sar10 Fmoc-Sar10	Biochemical Assay Reagents	Others
Fmoc-N(Me)-Sar10 (Fmoc-Sar10) is an Fmoc-protected derivative of a methylated sarcosine decamer, which supports cell adhesion, proliferation, and maintenance of cell phenotype. Fmoc-N(Me)-Sar10 is primarily used in peptide synthesis to introduce enzymatically stable spacer sequences. By mimicking the extracellular matrix (ECM), Fmoc-N(Me)-Sar10 provides a 3D growth microenvironment for cells and is mainly used in tissue engineering and 3D cell culture, particularly suitable for in vitro culture studies of cells such as chondrocytes .

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Neurological Disease
KLTWQELYQLKYKGI is a VEGF mimetic peptide designed based on the VEGF helix sequence 17-25, with the ability to activate VEGF receptors and exert pro-angiogenic biological activity. KLTWQELYQLKYKGI effectively promotes the attachment, spreading and proliferation of human umbilical vein endothelial cells. KLTWQELYQLKYKGI enhances the proliferation, migration and osteogenic differentiation of bone marrow stromal cells (BMSCs). KLTWQELYQLKYKGI synergistically accelerates angiogenesis and bone regeneration in rat cranial defect models. KLTWQELYQLKYKGI can be used for the research of brain tissue engineering and traumatic brain injury repair and biomaterials for bone tissue engineering and bone repair .

HY-P10026

Nisotirostide LY-3457263	Neuropeptide Y Receptor	Metabolic Disease
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .

HY-P10626

Nanodisc scaffold peptide NSPr	Peptides	Others
Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research .

HY-P1416A

Foxy-5 TFA Maximum Cited Publications 7 Publications Verification	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P11430

UBI (31-38)	Biochemical Assay Reagents	Infection
UBI (31-38) is a Ubiquicidin-derived octapeptide and anti-bacterial agent. UBI (31-38) selectively interacts with anionic phospholipid membranes and restricts lipid lateral motion. UBI (31-38) induces anionic vesicle aggregation via electrostatic repulsion screening, and undergoes conformational changes in membrane-mimicking environments. UBI (31-38) can be used for the research of infection imaging probes .

HY-N2466A

Melanotan I acetate 1 Publications Verification MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate	Melanocortin Receptor	Cancer
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .

HY-P10512

BDC2.5 mimotope	Peptides	Others
BDC2.5 mimotope is a potent antigen-mimicking peptide that can activate CD4+ T cell populations that have the same antigen recognition properties as BDC2.5 cells. BDC2.5 mimotope can be used to study the prevention or treatment of type 1 diabetes by targeting specific T cell populations .

HY-P10302

GLP-1R/GIPR agonist-1	GLP Receptor Insulin Receptor	Metabolic Disease
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .

HY-P10428

*E6AP-mimicking* peptide**	HPV	Infection
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a K_i of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .

HY-P5171

MDGCEL	Wnt	Cancer
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .

HY-P11204

DDDEEKC	Peptide-Drug Conjugates (PDCs)	Others
DDDEEKC is a bioinspired peptide sequence that can selectively adsorb onto the enamel surface (mimicking the role of salivary acquired pellicle protein statherin), acting as a "target - guiding agent" for tooth enamel remineralization. DDDEEKC enhances the regeneration of hydroxyapatite (HAP). DDDEEKC is promising for research of in-situ remineralization repair of enamel demineralization damage (such as dental caries) .

HY-P10356

T100-Mut	TRP Channel	Others
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P4863

Biotinyl-Amylin (human)	CGRP Receptor	Neurological Disease Metabolic Disease
Biotinyl-Amylin (human) is a biotin-labeled derivative of Amylin, amide, human (HY-P1070). Biotinyl-Amylin (human) acts as a competitive agonist for the Calcitonin Receptor (CTR) and for the Amylin receptors (AMY₁, AMY₂, and AMY₃) formed by the association of CTR with RAMP1/2/3. By mimicking endogenous human amylin, Biotinyl-Amylin (human) binds to and activates CTR and AMY receptors, thereby initiating downstream signaling pathways involving cAMP, CREB, and ERK1/2, while retaining high-affinity receptor binding and activation capabilities. Biotinyl-Amylin (human) is primarily utilized in studies investigating the metabolic regulatory mechanisms underlying obesity and diabetes; it is also applicable to pharmacological research, receptor localization studies, and ligand-binding assays related to Amylin receptors in the context of Alzheimer's disease .

HY-P5371

TFLLRNPNDK-NH2	Thrombin	Others
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P11590

WGYRGFYC	EGFR	Cancer
WGYRGFYC (WC8) is a selective HER2-targeting peptide that binds specifically to HER2 by mimicking the antigen-binding site of trastuzumab. The DOTA precursor of WGYRGFYC has a K_D of 61.20 nM for HER2. WGYRGFYC enables specific and highly sensitive detection of HER2 expression in HER2-positive breast cancer cells and tumor tissues, and monitors the dynamic downregulation of HER2 expression. WGYRGFYC rapidly distributes to target tissues and is efficiently cleared from non-target tissues via the kidneys, generating an ideal tumor-to-background ratio in imaging; it is a component of the PET radiotracer Ga-DOTA-WC8. WGYRGFYC exhibits no significant cytotoxicity in breast cancer cells, and can be used for non-invasive imaging diagnosis and therapeutic efficacy evaluation of HER2-positive breast cancer .

Cat. No.	Product Name	Target	Research Area	Image

HY-P991069

VRC-01	HIV	Infection
VRC-01 is a broadly neutralizing IgG1 monoclonal antibody that targets HIV-1 envelope glycoprotein gp120 Protein. VRC-01 blocks HIV-1 viral entry by mimicking CD4 receptor interaction with HIV-1 gp120 and neutralizes broad HIV-1 clades. VRC-01 can be used for the research of HIV-1 infection .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-17551

NMDA 25+ Cited Publications N-Methyl-D-aspartic acid	Ketones, Aldehydes, Acids Endogenous metabolite Source Classification	iGluR Endogenous Metabolite
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

HY-N11420

Coronatine	Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Other Diseases Disease Research Fields Source Classification Agricultural Research	Bacterial Phytohormone
Coronatine is a plant growth regulator that mimicks the jasmonic acid-isoleucine conjugate (JA-Ile), targets the jasmonic acid receptor COI1, activates the jasmonic acid signaling pathway, thereby inhibiting salicylic acid (SA)-dependent defense responses. Coronatine antagonizes the stomatal closure, induces plant cell necrosis and chlorosis, interfers with plant hormone balance, thereby promoting pathogen infection .

HY-B1306

4-Aminohippuric acid 4 Publications Verification p-Aminohippuric acid	Classification of Application Fields Ketones, Aldehydes, Acids Other Diseases Endogenous metabolite Disease Research Fields Source Classification	Others
4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

HY-N3021

D-chiro-Inositol	Natural Products Classification of Application Fields Metabolic Disease Endogenous metabolite Disease Research Fields Source Classification	Endogenous Metabolite NF-κB TNF Receptor FOXO Microtubule/Tubulin
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .

HY-B1306R

4-Aminohippuric acid (Standard) p-Aminohippuric acid (Standard)	Structural Classification Ketones, Aldehydes, Acids Endogenous metabolite Source Classification	Reference Standards Biochemical Assay Reagents
4-Aminohippuric acid (p-Aminohippuric acid) (Standard) is the analytical standard of 4-Aminohippuric acid (HY-B1306). This product is intended for research and analytical applications. 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

HY-N3021R

D-chiro-Inositol (Standard)	Structural Classification Natural Products Endogenous metabolite Source Classification	Reference Standards Endogenous Metabolite NF-κB TNF Receptor FOXO Microtubule/Tubulin
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .

HY-W015752R

5-Methoxyresorcinol (Standard)	Phenols Polyphenols Endogenous metabolite Source Classification	Reference Standards Drug Intermediate
5-Methoxyresorcinol (Standard) is an analytical standard for 5-Methoxyresorcinol (HY-W015752). This product is intended for research and analytical applications. 5-Methoxyresorcinol is a model molecule for the A ring of flavonoids, specifically mimicking the chemical behavior of the resorcinol-type A ring in catechins. 5-Methoxyresorcinol exhibits very low tocopherol regeneration activity. 5-Methoxyresorcinol shows little inhibition of cholesteryl ester transfer protein (CETP).

Cat. No.	Product Name	Chemical Structure

HY-B1306S

4-Aminohippuric acid-d4

4-Aminohippuric acid-d₄ (p-Aminohippuric acid-d₄) is the deuterium labeled 4-Aminohippuric acid (HY-B1306). 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

HY-76737S

4-Chlorodiphenyl ether-d5
4-Chlorodiphenyl ether-d₅ (4-CDE-d₅) is the deuterium labeled 4-Chlorodiphenyl ether. 4-Chlorodiphenyl ether is an estrogen-mimicking active compound. 4-Chlorodiphenyl ether maintains the survival of endometriotic cysts and exhibits estrogenic activity associated with the growth of endometriotic implants. 4-Chlorodiphenyl ether can be used in research related to endometriosis.

Cat. No.	Product Name		Classification

HY-142991

1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylglycerol POPG		Phospholipids
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylglycerol (POPG) is an anionic phosphatidylglycerol that often serves as a key component to co-construct model phospholipid bilayers with phosphatidylcholine (e.g., at a 3:1 POPC:POPG ratio) for investigating the structure and dynamics of transmembrane proteins. 1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylglycerol acts as a fundamental material for mimicking the physicochemical properties of biological membranes and enables the elucidation of membrane protein interaction mechanisms .

HY-W142596

1,2-DImyristoyl-rac-glycero-3-phosphocholine		Phospholipids
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .

HY-D2361

Adenosine 2'-PEG-Biotin		Nucleoside Analogs Adenosine
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

mimicking

Inhibitors & Agonists

Fluorescent Dyes

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

NaturalProducts

Isotope-Labeled Compounds

Oligonucleotides

Natural
Products