SCF Protein, Human (P.pastoris)
Based on 1 Customer Validation
SCF Protein, Human (P.pastoris), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
SCF Protein, Human (P.pastoris), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.
The recombinant human stem cell factor (rhSCF) protein specifically enhances the viability of human myeloid leukemia cell line TF-1 and the proliferation and maturation of human mast cell line LAD2 cell. Recombinant human SCF (rhSCF) can maintain hematopoietic stem cells and mast cell in culture, and it is widely tested in research into differentiation from embryonic stem cell (ESC)/induced pluripotent stem cell (iPSC)[1].
The ED50 is <2 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of 5 × 105 units/mg.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag Tag Free
-
Accession
P21583-1 (E26-A189)
-
Molecular Construction
-
N-term
-
SCF (E26-A189)
Accession # P21583-1 -
C-term
-
-
Protein Length
Full Length of Soluble KIT ligand
-
Synonyms
KITLG; SLF; Prev. MGF; Familial Progressive Hyperpigmentation 2; SCF; Steel Factor; Mast Cell Growth Factor; C-Kit Ligand; Stem Cell Factor; Kit Ligand; DFNA69; SHEP7; Kitl; DCUA; KL-1; FPHH; FPH2; WS2F; KIT Ligand; SF
-
AA Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM acetic acid.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
