TPO/Thrombopoietin Protein, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO)，also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Recombinant thrombopoietin reduced radiation- and chemotherapy-induced thrombocytopenia, enhanced platelet recovery after bone marrow transplantation and increased the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold^[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates^[2].

The ED₅₀ is typically 1-200 ng/mL as measured by MO7e human megakaryocytic leukemic cells in a cell proliferation assay.

Human

CHO

C-His

P40225 (S22-G353)

7066  [NCBI]

MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Approximately 60-80 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Kuter DJ, et al. Thrombopoietin: Biology and Clinical Applications. Oncologist. 1996;1(1 & 2):98-106.  [Content Brief]

  [2]. Hitchcock IS, et al. Thrombopoietin from beginning to end. Br J Haematol. 2014 Apr;165(2):259-68.  [Content Brief]