Copy Link Print Information

TPO/Thrombopoietin Protein, Human (CHO, His, solution)

Customer Review

Based on 1 Customer Validation

TPO/Thrombopoietin Protein, Human (CHO, His, solution), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for TPO/Thrombopoietin Protein, Human (CHO, His, solution)
  • TPO/Thrombopoietin Protein, Human (CHO, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TPO/Thrombopoietin Protein, Human (CHO, His, solution), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Background

Recombinant thrombopoietin reduced radiation- and chemotherapy-induced thrombocytopenia, enhanced platelet recovery after bone marrow transplantation and increased the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates[2].

Verified Bioactivity

The ED50 is typically 0.5-5 ng/mL as measured by MO7e human megakaryocytic leukemic cells in a cell proliferation assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag C-His
  • Accession

    P40225-1 (S22-G353)

  • Gene ID
    7066  [NCBI]
  • Molecular Construction
    • N-term
    • TPO (S22-G353)
      Accession # P40225-1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    THPO; Prepro-Thrombopoietin; Prev. MGDF; MPL Ligand; Myeloproliferative Leukemia Virus Oncogene Ligand; ML; Megakaryocyte Growth And Development Factor; Thrombopoietin Nirs Variant 3; Megakaryocyte Colony-Stimulating Factor; Thrombopoietin Nirs Variant 2;

  • AA Sequence

    SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

  • Predicted Molecular Mass

    36.9 kDa

  • Molecular Weight

    Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Kuter DJ, et al. Thrombopoietin: Biology and Clinical Applications. Oncologist. 1996;1(1 & 2):98-106. [Content Brief]

[2]. Hitchcock IS, et al. Thrombopoietin from beginning to end. Br J Haematol. 2014 Apr;165(2):259-68. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • TPO/Thrombopoietin Protein, Human (CHO, His, solution) Product Image
    1/16
  • Experimental Validation Results for TPO/Thrombopoietin Protein, Human (CHO, His, solution)
  • TPO/Thrombopoietin Protein, Human (CHO, His, solution) Product Image