1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SCF Protein, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The GMP stem cell factor (SCF) protein serves as a ligand for the receptor-type protein-tyrosine kinase KIT, playing a pivotal role in the regulation of diverse cellular processes. Its functions span the control of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding with KIT, GMP SCF activates multiple signaling pathways, including the phosphorylation of PIK3R1 and subsequent activation of the kinase AKT1. The interaction also triggers signaling cascades involving GRB2, RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, GMP SCF and KIT promote the activation of STAT family members (STAT1, STAT3, and STAT5), as well as PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Acting synergistically with other cytokines, likely interleukins, GMP SCF forms a homodimer non-covalently linked and a heterotetramer with KIT, facilitating KIT dimerization and subsequent activation through autophosphorylation.

Actividad biológica

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 this effect is 1-10 ng/mL.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.097 ng/mL, corresponding to a specific activity is 9.12×105 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P21583-1 (E26-H214)

Gene ID
Molecular Construction
N-term
SCF (E26-H214)
Accession # P21583-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF
AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Predicted Molecular Mass
22 kDa
Peso molecular

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

SCF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

SCF Protein, Human (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
SCF Protein, Human (HEK293, His)
Cat. No.:
HY-P70757
Cantidad:
MCE Japan Authorized Agent: