Copy Link Print Information

IL-3 Protein, Human

Customer Review

Based on 1 Customer Validation

IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-3 Protein, Human
  • Experimental Validation Results for IL-3 Protein, Human
  • IL-3 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

Background

Interleukin-3 (IL-3) is aglycoprotein belonging to the hematopoietic growth factor family that in preclinical in vitro and in vivo studies has exhibited a multilineage activity. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF)[1]. Human interleukin-3 (hIL-3) is a multipotent hematopoietic cytokine produced by mitogen and antigen-activated keratinocytes, T-lymphocytes, mast cells, NK cells, monocytes and endothelial cells. The hematopoietic progenitor cells are proliferated and differentiated with the help of hIL-3 protein into mature erythrocytes, mast cells, megakaryocytes and granulocytes. The potential use of hIL-3 protein has been extensively tested in various clinical applications such as bone marrow transplantation, hematological malignancies, cytopenias, aplastic anemia and various types of cancer[2].

In Vitro

IL-3 Protein (Human, 1-50 U/mL, 6 days) induces short-term proliferation of human peripheral blood lymphocytes and T cells[3].
IL-3 Protein (Human, 1-100 U/mL, 14 days) promotes the differentiation of basophils and eosinophils, enhances the production of histamine in rhesus monkey bone marrow cells[4].

In Vivo

IL-3 Protein (Human, 100 µg/kg/day, sc, three times daily for 14 days) increases the number of leukocytes, increases the level of total histamine and plasma histamine in rhesus monkeys[4].

Verified Bioactivity

The ED50 is <0.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >1 × 107 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P08700 (A20-F152)

  • Gene ID
    3562  [NCBI]
  • Molecular Construction
    • N-term
    • IL-3 (A20-F152)
      Accession # P08700
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I

  • AA Sequence

    APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

  • Molecular Weight

    Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24(7):839-47. [Content Brief]

[2]. Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009. [Content Brief]

[3]. Santoli D, et al., Amplification of IL-2-driven T cell proliferation by recombinant human IL-3 and granulocyte-macrophage colony-stimulating factor. J Immunol. [Content Brief]

[4]. Mayer P, et al. The in vivo effects of recombinant human interleukin-3: demonstration of basophil differentiation factor, histamine-producing activity, and priming of GM-CSF-responsive progenitors in nonhuman primates[J]. 1989.

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The ED50 is <0.5 ng/mL as measured by measured by its ability to stimulate the proliferation of TF-1 cells.

  • IL-3 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-3 Protein, Human
  • Experimental Validation Results for IL-3 Protein, Human
  • IL-3 Protein, Human Product Image