Animal-Free IL-6 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

GMP IL-6 Protein, a versatile cytokine, performs various biological functions in immunity, tissue regeneration, and metabolism. Upon binding to IL6R, the resulting complex associates with the signaling subunit IL6ST/gp130, triggering the intracellular IL6-signaling pathway. Its interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling,' while the binding of IL6 and soluble IL6R to IL6ST induces 'trans-signaling.' Moreover, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly mobilizing host defenses during infection and tissue injury, although excessive IL6 synthesis is implicated in disease pathology. In the innate immune response, IL-6 is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognizing pathogens through toll-like receptors at the infection or tissue injury site. In the adaptive immune response, IL-6 is essential for B-cell differentiation into immunoglobulin-secreting cells and plays a major role in the differentiation of CD4(+) T cell subsets. It is a crucial factor in the development of T follicular helper (Tfh) cells necessary for germinal-center formation and is required to drive naive CD4(+) T cells to the Th17 lineage. Additionally, IL-6 is essential for the proliferation of myeloma cells and the survival of plasmablast cells.

Verified Bioactivity

1.Measure by its ability to induce proliferation in TF-1 cells The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 108 IU/mg.
2.Measure by its ability to induce proliferation in MCF-7 cells. The ED50 for this effect is <4.4 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-6 (P30-M212)
      Accession # P05231
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ

  • AA Sequence

    VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

  • Predicted Molecular Mass

    21.8 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose or PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00