Neurturin Protein, Human
Based on 1 Customer Validation
Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free.
Neurturin protein, a vital factor in neurobiology, plays a key role in supporting the survival of sympathetic neurons in culture. Beyond its role in neuronal survival, Neurturin is suggested to have regulatory functions in the development and maintenance of the central nervous system (CNS), influencing the intricate processes governing neural growth and stability. Additionally, there is a potential involvement in modulating the size of non-neuronal cell populations, such as haemopoietic cells, underscoring its broader impact on cellular dynamics. Neurturin functions as a homodimer, held together by disulfide linkages, emphasizing its structural integrity in executing its diverse cellular functions.
Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 31.8 ng/mL in the presence of 100 ng/mL Human GFR alpha-2, corresponding to a specific activity is 3.145×104 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99748 (A96-V197)
-
Molecular Construction
-
N-term
-
Neurturin (A96-V197)
Accession # Q99748 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NRTN; NTN; Neurturin; Prepro-Neurturin
-
AA Sequence
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
-
Predicted Molecular Mass
11.8 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 6% sucrose, 4% mannitol, 0.05% Tween 80, pH 4.0.
2.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
