YAP1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.

Background

YAP1, a multifaceted transcriptional regulator, serves as a critical downstream target in the Hippo signaling pathway, orchestrating organ size control and tumor suppression by modulating proliferation and apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1, in coordination with SAV1, phosphorylate and activate LATS1/2, leading to the phosphorylation and inactivation of YAP1 and WWTR1/TAZ oncoproteins. YAP1 is pivotal in regulating tissue tension and 3D tissue shape by influencing cortical actomyosin network formation through ARHGAP18. Moreover, it plays a key role in controlling cell proliferation, with its nuclear translocation inhibited by LATS1/2 phosphorylation. YAP1's collaboration with TEAD transcription factors is essential for stimulating gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Additionally, it suppresses ciliogenesis by acting as a transcriptional corepressor of TEAD4 target genes AURKA and PLK1, and in conjunction with WWTR1, it regulates TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. YAP1 further activates the C-terminal fragment (CTF) of ERBB4 isoform 3.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • YAP1 (M1-L504)
      Accession # P46937
    • 10*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YAP1; YAP65; Transcriptional coactivator YAP1; Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog

  • AA Sequence

    MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

  • Predicted Molecular Mass

    64.2 kDa

  • Molecular Weight

    Approximately 90 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00