YAP1 Protein, Human (His)
Based on 1 Customer Validation
YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.
YAP1, a multifaceted transcriptional regulator, serves as a critical downstream target in the Hippo signaling pathway, orchestrating organ size control and tumor suppression by modulating proliferation and apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1, in coordination with SAV1, phosphorylate and activate LATS1/2, leading to the phosphorylation and inactivation of YAP1 and WWTR1/TAZ oncoproteins. YAP1 is pivotal in regulating tissue tension and 3D tissue shape by influencing cortical actomyosin network formation through ARHGAP18. Moreover, it plays a key role in controlling cell proliferation, with its nuclear translocation inhibited by LATS1/2 phosphorylation. YAP1's collaboration with TEAD transcription factors is essential for stimulating gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Additionally, it suppresses ciliogenesis by acting as a transcriptional corepressor of TEAD4 target genes AURKA and PLK1, and in conjunction with WWTR1, it regulates TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. YAP1 further activates the C-terminal fragment (CTF) of ERBB4 isoform 3.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
P46937 (M1-L504)
-
Gene ID10413
-
Molecular Construction
-
N-term
-
YAP1 (M1-L504)
Accession # P46937 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
YAP1; YAP65; Transcriptional coactivator YAP1; Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog
-
AA Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
-
Predicted Molecular Mass
64.2 kDa
-
Molecular Weight
Approximately 90 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)