1. Search Result
Search Result
Results for "

MIP

" in MedChemExpress (MCE) Product Catalog:

40

Inhibitors & Agonists

7

Peptides

4

Natural
Products

58

Recombinant Proteins

19

Antibodies

8

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-B0498
    Bindarit
    25+ Cited Publications

    AF2838

    CCR Neurological Disease Inflammation/Immunology Endocrinology Cancer
    Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity .
    Bindarit
  • HY-B2176R

    Adenosine 5'-triphosphate (Standard)

    Reference Standards Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    ATP (Standard) is the analytical standard of ATP. This product is intended for research and analytical applications. ATP (Adenosine 5'-triphosphate) is a central component of energy storage and metabolism in vivo. ATP provides the metabolic energy to drive metabolic pumps and serves as a coenzyme in cells. ATP is an important endogenous signaling molecule in immunity and inflammation . In Vitro: ATP (5 mM; 1 hour) co-treatment with LPS (1 μg/mL) has a synergistic effect on the activation of the NLRP3 inflammasome in HGFs .
    ATP (2 mM; 0.5-24 hours) induces secretion of IL-1β, KC and MIP-2 from BMDMs in a caspase-1 activation-dependent manner .
    ATP promotes neutrophil chemotaxis in vitro .
    In Vivo: ATP (50 mg/kg; i.p.) protects mice against bacterial infection in vivo .
    ATP induces the secretion of IL-1β, KC and MIP-2 and neutrophils recruitment in vivo .
    ATP (Standard)
  • HY-139644

    Adenosine Receptor Neurological Disease
    MIPS521 is a positive allosteric modulator of adenosine A1 receptor (A1AR). MIPS521 also has a lower A1R allosteric affinity (pKB=4.95; KB=11 μM). MIPS521 exhibits pain-relieving effects in vivo through modulation of the increased levels of endogenous adenosine .
    MIPS521
  • HY-156371

    PI3K Cardiovascular Disease Metabolic Disease
    MIPS-21335 is a PI3KC2α inhibitor with an IC50 of 7 nM. MIPS-21335 also inhibits PI3KC2β, p110α, p110β and p110δ, with IC50 values of 43, 140, 386 and 742 nM, respectively. MIPS-21335 has antithrombotic effect. MIPS-21335 can be used for the researches of cardiovascular disease and metabolic disease, such as thrombosis and hyperlipidemia .
    MIPS-21335
  • HY-P5523A

    NOD-like Receptor (NLR) NF-κB Interleukin Related Metabolic Disease
    iE-DAP dihydrochloride is a Nod1 agonist. iE-DAP dihydrochloride activates NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP dihydrochloride downregulates the expression of ZO-1 and Occludin genes. iE-DAP dihydrochloride increases the secretion of IL-6, GRO-α, MCP-1, IL-8 and MIP-1β in term human trophoblast cell cultures. iE-DAP dihydrochloride triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP dihydrochloride can be used in studies related to mastitis and preterm birth .
    iE-DAP dihydrochloride
  • HY-19974
    TAK-220
    3 Publications Verification

    CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-W014081

    Ethyl 2-oxo-2H-chromene-3-carboxylate

    Drug Derivative Others
    Ethyl 3-coumarincarboxylate is a coumarin derivative. Ethyl 3-coumarincarboxylate can be used as a pseudo-template to give a molecularly imprinted polymer (MIP) that has a fairly specific recognition capability for aflatoxins .
    Ethyl 3-coumarincarboxylate
  • HY-N10116A

    Interleukin Related IFNAR Calcium Channel Bacterial CCR Infection Cancer
    Calamenene is a sesquiterpene compound . Calamenene promotes dendritic cell maturation, upregulates CD1a, CD80, CD83, CD86, HLA-DR and CCR7 on the cell surface, reduces endocytic activity, enhances T cell-stimulating capacity, drives Th1 polarization through the secretion of IL-12, induces IFN-γ production, decreases IL-4 generation, and triggers intracellular Ca 2+ mobilization as well as dendritic cell migration towards MIP-3β. Calamenene exerts bacteriostatic and bactericidal growth-inhibitory effects against pathogenic *Vibrio harveyi*. Calamenene can be used in studies related to cancer and bacterial infections .
    Calamenene
  • HY-129615

    PSMA Cancer
    MIP-1072 is a small molecule specific prostate-specific membrane antigen (PSMA) inhibitor. MIP-1072 inhibits the glutamate carboxypeptidase activity of PSMA with an Ki value of 4.6 nM. MIP-1072 is promising for research of prostate cancer .
    MIP-1072
  • HY-123733

    RPS-001

    PSMA Others Cancer
    MIP-1095 potently inhibits the glutamate carboxypeptidase activity of PSMA (Ki =0.24 nM) .
    MIP-1095
  • HY-123733A

    RPS-001 TFA

    PSMA Cancer
    MIP-1095 (RPS-001) TFA is a potent inhibitor of PSMA with good biodistribution and efficient targeting of tumor lesions. In applications, MIP-1095 TFA will be isotopically labeled ( 131I labeled) as an imaging probe to indicate tumor progression. And 131I-MIP-1095 showed higher renal uptake in mice .
    MIP-1095 TFA
  • HY-120265

    PI3K Cardiovascular Disease
    MIPS-9922 is a potent and selective PI3Kβ inhibitor with an IC50 of 63 nM. MIPS-9922 inhibits PI3Kβ with >30-fold higher potency than PI3Kδ. MIPS-9922 blocks PI3K mediated activation of platelet glycoprotein αIIbβ3 activation and platelet adhesion in vitro. MIPS-9922 shows anti-platelet and anti-thrombotic activities .
    MIPS-9922
  • HY-P5523

    NOD-like Receptor (NLR) NF-κB Interleukin Related Metabolic Disease
    iE-DAP is a Nod1 agonist. iE-DAP activates NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP downregulates the expression of ZO-1 and Occludin genes. iE-DAP increases the secretion of IL-6, GRO-α, MCP-1, IL-8 and MIP-1β in term human trophoblast cell cultures. iE-DAP triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP is applicable to research related to mastitis and preterm birth .
    iE-DAP
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-179277

    Adenosine Receptor Cardiovascular Disease
    MIPS3526 is a potent and selective A2B adenosine receptor (A2BR) agonist with a pEC50 of 10.17 (EC50 of 58 pM). MIPS3526 shows highly receptor subtype selective versus the A1R, A2AR, and A3R. MIPS3526 ameliorates angiotensin II stimulating effects in both cardiac myocytes and fibroblasts. MIPS3526 can be used for the study of cardiovascular disease including heart failure where cardiac remodeling is a major driver .
    MIPS3526
  • HY-149650

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1
  • HY-149650A

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1 TEA
  • HY-B0155

    SCH 417690; SCH-D; MK-7690 free base

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-P11093

    Antibiotic Bacterial Fungal Apoptosis Reactive Oxygen Species (ROS) TNF Receptor NO Synthase Interleukin Related NF-κB Toll-like Receptor (TLR) Infection Inflammation/Immunology
    Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is primarily active against Gram-negative bacteria. Papiliocin exhibits strong anti-inflammatory activity against cell, exerting its anti-inflammatory activity by inhibiting the production of NO and the secretion of TNF-α and MIP-2. Papiliocin participates in the innate defense response mechanism by inhibiting the Toll-like receptor pathway and NF-κB. Papiliocin induces apoptosis in fungal cells and increases the total level of intracellular ROS. Papiliocin acts as an effective antiseptic peptide in sepsis models. Papiliocin is useful in anti-inflammatory and antibacterial research .
    Papiliocin
  • HY-168149

    Others Cancer
    Mip-IN-2 (compound 5b) is a macrophage infection-promoting protein (MIP) protein.
    Mip-IN-2
  • HY-149861

    Bacterial Infection
    Mip-IN-1(S,S-28i)is a new rapamycin-derived macrophage infectivity potentiator (Mip) inhibitor. Mip-IN-1 displays strong anti-enzymatic activity against the Mip proteins of Neisseria meningitidis and Neisseria gonorrhoeae and substantially improved the ability of macrophages to kill the bacteria .
    Mip-IN-1
  • HY-RS19300

    Small Interfering RNA (siRNA) Others

    Mip Mouse Pre-designed siRNA Set A contains three designed siRNAs for Mip gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mip Mouse Pre-designed siRNA Set A
    Mip Mouse Pre-designed siRNA Set A
  • HY-RS08460

    Small Interfering RNA (siRNA) Others

    MIP Human Pre-designed siRNA Set A contains three designed siRNAs for MIP gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MIP Human Pre-designed siRNA Set A
    MIP Human Pre-designed siRNA Set A
  • HY-RS08461

    Small Interfering RNA (siRNA) Others

    MIPEP Human Pre-designed siRNA Set A contains three designed siRNAs for MIPEP gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MIPEP Human Pre-designed siRNA Set A
    MIPEP Human Pre-designed siRNA Set A
  • HY-RS14859

    Small Interfering RNA (siRNA) Others

    TNPO1 Human Pre-designed siRNA Set A contains three designed siRNAs for TNPO1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    TNPO1 Human Pre-designed siRNA Set A
    TNPO1 Human Pre-designed siRNA Set A
  • HY-P3627

    Drug Derivative Cancer
    Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis .
    Nagrestipen
  • HY-103360B

    CCR Inflammation/Immunology
    trans-J-113863 is a potent chemokine CCR1 and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC50 of 9.57 and 93.8 nM,respectively .
    trans-J-113863
  • HY-118962

    CCR HIV Infection
    E913 is a CCR5 antagonist that competes with the binding of antibodies to CCR5 which recognize the C-terminal half of the second extracellular loop (ECL2B) of CCR5. E913 can specifically block the binding of macrophage inflammatory protein-1alpha (MIP-1alpha) to CCR5 (IC50 = 0.002 μM) and MIP-1alpha-elicited cellular Ca 2+ mobilization (IC50 = 0.02 μM). E913 inhibits the replication of laboratory and primary R5 HIV-1 strains as well as various multidrug-resistant monocyte/macrophage tropic (R5) HIV-1 (IC50 = 0.03-0.06 μM). E913 can be used for the research of infection, such as HIV-1 infection .
    E913
  • HY-P11502

    Apolipoprotein NO Synthase CXCR NF-κB IKK Infection
    COG112 is an antennapedia-linked apoE-mimetic peptide. COG112 attenuates induction of NO production, inhibits CXC chemokines KC and MIP-2. COG112 reduces nuclear translocation of NF-κB. COG112 inhibits phosphorylation of IκB-α and prevents the degradation of IκB-α. COG112 inhibits the inflammatory response to Citrobacter rodentium .
    COG112
  • HY-161901

    E1/E2/E3 Enzyme Inflammation/Immunology
    BC-1293 is an inhibitor for E3 ligase subunit FBXO24. BC-1293 disrupts the interaction between FBXO24 and aspartyl-tRNA synthetase (DARS2) and increases the level of DARS2. BC-1293 increases levels of IL-1β, IL-9, MIP-2, and TNF α, and exhibits immunostimulatory activity in mice .
    BC-1293
  • HY-B0155B

    SCH 417690 malate; SCH-D malate; MK-7690

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-174744

    mRNA Inflammation/Immunology
    Human CCR4 mRNA encodes the human C-C motif chemokine receptor 4 (CCR4) protein, a member of G protein-coupled receptors family. CCR4 is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.
    Human CCR4 mRNA
  • HY-15544

    CCR Inflammation/Immunology
    CCR1 antagonist 10 (example 1) is a potent and orally active CCR1 antagonist. CCR1 antagonist 10 inhibits 125I-MIP-1α binding to THP-1 cell membranes with an Ki value of 2.3 nM .
    CCR1 antagonist 10
  • HY-RS25791

    Small Interfering RNA (siRNA) Others

    Mip Rat Pre-designed siRNA Set A contains three designed siRNAs for Mip gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mip Rat Pre-designed siRNA Set A
    Mip Rat Pre-designed siRNA Set A
  • HY-110391

    VUF 2274

    CCR Neurological Disease Inflammation/Immunology
    BX-513 is a highly potent and selective CCR1 antagonist. BX-513 effectively inhibits the binding of radiolabeled MIP-1α and RANTES to CCR1, with Ki values of 40 nM and 60 nM, respectively. BX-513 suppresses MIP-1α-induced extracellular acidification, MIP-1α- and RANTES-induced intracellular calcium mobilization, as well as MIP-1α- and RANTES-induced migration of peripheral blood mononuclear cells. BX-513 can be used for the research of rheumatoid arthritis and multiple sclerosis .
    BX-513
  • HY-RS22639

    Small Interfering RNA (siRNA) Others

    Mipep Mouse Pre-designed siRNA Set A contains three designed siRNAs for Mipep gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mipep Mouse Pre-designed siRNA Set A
    Mipep Mouse Pre-designed siRNA Set A
  • HY-123661

    Endogenous Metabolite Neurological Disease
    MIPS1455 is a light-activated M1 muscarinic acetylcholine receptor ligand with irreversible binding activity to the allosteric site of the receptor. MIPS1455 is a drug target under investigation for the suppression of cognitive deficits and may become a valuable molecular tool for further investigation of allosteric interactions of the receptor .
    MIPS1455
  • HY-RS20118

    Small Interfering RNA (siRNA) Others

    Tnpo1 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Tnpo1 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Tnpo1 Mouse Pre-designed siRNA Set A
    Tnpo1 Mouse Pre-designed siRNA Set A
  • HY-N10175

    NO Synthase NF-κB ERK Interleukin Related TNF Receptor Reactive Oxygen Species (ROS) Inflammation/Immunology
    keleyacetal C, a meroterpenoid compound with anti-inflammatory effects via inhibiting NF-κB, ERK1/2 and IRF3 signaling pathways. Berkeleyacetal C significantly inhibits the expression of iNOS and the following NO production by macrophages. Berkeleyacetal C inhibits expression and secretion of key pro-inflammatory factors and chemokines (TNF-α, IL-6, IL-1β, MIP-1α, and MCP-1). Berkeleyacetal C also inhibits activation of neutrophils and reactive oxygen species (ROS) production. Berkeleyacetal C can be used for the study of inflammatory disorders .
    Berkeleyacetal C

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: