Copy Link Print Information

CXCL14/BRAK Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXCL14/BRAK protein selectively attracts CESS B cells and THP-1 monocytes without affecting T cells. Its specific chemical attraction emphasizes its role in mediating B cell and monocyte migration, contributing to immune responses within the microenvironment. CXCL14/BRAK Protein, Mouse (His) is the recombinant mouse-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CXCL14/BRAK Protein, Mouse (His)
  • Experimental Validation Results for CXCL14/BRAK Protein, Mouse (His)
  • CXCL14/BRAK Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CXCL14/BRAK protein selectively attracts CESS B cells and THP-1 monocytes without affecting T cells. Its specific chemical attraction emphasizes its role in mediating B cell and monocyte migration, contributing to immune responses within the microenvironment. CXCL14/BRAK Protein, Mouse (His) is the recombinant mouse-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

Background

CXCL14/BRAK protein functions as a chemotactic factor specifically attracting CESS B-cells and THP-1 monocytes, with no chemotactic effect on T-cells. This selective chemoattraction underscores its role in mediating the migration of B-cells and monocytes, contributing to immune responses within the microenvironment. The distinct chemotactic properties of CXCL14/BRAK highlight its specificity for certain immune cell types, suggesting a specialized role in regulating the recruitment and activation of B-cells and monocytes while not influencing T-cell migration.

Verified Bioactivity

1. The biological activity determined by a chemotaxis bioassay using THP-1 human monocytic leukemia cells.The ED50 for this effect is 1.081 ng/mL, corresponding to a specific activity is 9.25×105 units/mg.
2. Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 1-5 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    The biological activity determined by a chemotaxis bioassay using THP-1 human monocytic leukemia cells.The ED50 for this effect is 1.081 ng/mL, corresponding to a specific activity is 9.25×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q9WUQ5 (S23-E99)

  • Gene ID
    57266  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • Cxcl14 (S23-E99)
      Accession # Q9WUQ5
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL14; Kec; Prev. SCYB14; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 14 (BRAK); NJAC; Chemokine (C-X-C Motif) Ligand 14; Small-Inducible Cytokine B14; Breast And Kidney; C-X-C Motif Chemokine 14; MIP-2G; Chemokine BRAK; MIP2G; Bolekine; CXC

  • AA Sequence

    SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

  • Predicted Molecular Mass

    9.4 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 300 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The biological activity determined by a chemotaxis bioassay using THP-1 human monocytic leukemia cells.The ED50 for this effect is 1.081 ng/mL, corresponding to a specific activity is 9.25×105 units/mg.

  • CXCL14/BRAK Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for CXCL14/BRAK Protein, Mouse (His)
  • Experimental Validation Results for CXCL14/BRAK Protein, Mouse (His)
  • CXCL14/BRAK Protein, Mouse (His) Product Image